Property Summary

NCBI Gene PubMed Count 15
PubMed Score 56.30
PubTator Score 27.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Gene RIF (4)

PMID Text
26537946 genome-wide association studies in populations in Argentina/Bangladeshi: Three SNPs in INMT (rs6970396, rs1061644, rs4270015) are associated with production of trimethylselenonium (TMSe); urinary Se excretion is up-regulated in TMSe-producing women.
26183064 study suggests that rs77743549 of INMT may be associated with the risk for Hirschsprung's disease
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLIDIGSGPTIYQ      1 - 70
VLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGNSGRWEEKEEKLRAAVKRVLK     71 - 140
CDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLLKPGGHLVTTVTLRLPSYMVGKRE    141 - 210
FSCVALEKEEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCFIVARKKPGP                     211 - 263
//

Text Mined References (17)

PMID Year Title
26537946 2015 Selenium metabolism to the trimethylselenonium ion (TMSe) varies markedly because of polymorphisms in the indolethylamine N-methyltransferase gene.
26183064 2015 Potential Association of INMT Nonsynonymous Variant (His46Pro) with Hirschsprung's Disease.
25416956 2014 A proteome-scale map of the human interactome network.
22396660 2012 A genome-wide association study of nephrolithiasis in the Japanese population identifies novel susceptible Loci at 5q35.3, 7p14.3, and 13q14.1.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18394749 2008 Differences in gene expression levels between early and later stages of human lung development are opposite to those between normal lung tissue and non-small lung cell carcinoma.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16095048 2005 Potentially hallucinogenic 5-hydroxytryptamine receptor ligands bufotenine and dimethyltryptamine in blood and tissues.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15014171 2004 Human-specific amino acid changes found in 103 protein-coding genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11322482 2001 Arylamine N-methyltransferase and thiol methyltransferase activities in cholestatic rat liver induced by common bile duct ligation.
10552930 1999 Human indolethylamine N-methyltransferase: cDNA cloning and expression, gene cloning, and chromosomal localization.
192352 1977 Plasma indolethylamine-n-methyltransferase activity and growth hormone level during sleep: a pilot study.