Property Summary

NCBI Gene PubMed Count 31
PubMed Score 10.86
PubTator Score 9.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6685 1.0e-07
osteosarcoma 7933 1.3e-06
pancreatic ductal adenocarcinoma liver metastasis 1795 3.8e-02
Disease Target Count Z-score Confidence
Gout 93 3.205 1.6
Disease Target Count Z-score Confidence
Gastric diffuse adenocarcinoma 1 3.33 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.297 1.3e-06
pancreatic ductal adenocarcinoma liver m... -1.057 3.8e-02
psoriasis -1.100 1.0e-07

Gene RIF (21)

PMID Text
25062451 Activin A, B, and AB have similar effects on steroidogenesis in human granulosa cells; in contrast, activin AC is not biologically active and does not act as a competitive antagonist.
24599287 Serum inhibin levels correlate with clinical characteristics and mortality in epithelial ovarian cancer patients.
23580013 The inhibin-betaC subunit is down-regulated, while inhibin-betaE is up-regulated by interferon-beta1a in Ishikawa carcinoma cell line.
23284751 Single Nucleotide Polymorphisms in INHBC gene is associated with brain metastasis in non-small-cell lung cancer
23180294 Activin-beta(C) is a regulator of activin-A. Activin-beta(C) is able to abolish cachexia and modulate reproductive tumour development in inhibin alpha-subunit knockout mice (alpha-KO) mice.
21529351 Data show that inhibin A levels were significantly lower in the PCOS group compared to the control group, and inhibin B levels were comparable in the two groups.
21117833 inhibin-betaC in normal and pathological placental tissue was demonstrated, although no differences in staining intensity could be observed. Functional role of novel inhibin-betaC subunit in normal and pathological human placenta is still quite unclear.
21092084 differential expression pattern of the betaC- and betaE-subunits in normal human endometrial tissue suggests that they function in endometrial maturation and blastocyst implantation.
21063444 Observational study of gene-disease association. (HuGE Navigator)
20952735 the novel inhibin/activin-betaC subunit is expressed in human endometrioid adenocarcinomas and in the human endometrial carcinoma cell line HEC-1a
20884846 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20683603 in endometrial cancer tissue demonstrated a significant association with hemangiosis although without any impact on the patients' survival
20458061 Expression of inhibin beta C was detected in the human chorionic carcinoma cell lines JEG and BeWoand also in human placenta.
20012305 Expression of the inhibin betaC and betaE subunits was demonstrated at the protein level and at the transcriptional level in normal human endometrial tissue and in the Ishikawa human endometrial carcinoma cell line.
19095948 activin-beta(C) is an antagonist of activin A
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18413775 Observational study of gene-disease association. (HuGE Navigator)
16627954 activin betaC subunit may exert its effect as inhibin C
12960042 Role for the activin betaC-subunit as a regulatory mechanism to reduce activin A secretion via intracellular heterodimerization.
12651901 Results quantify the relative expression of inhibin alpha, inhibin/activin beta(A), beta(B), beta(C), follistatin, activin receptors and beta-glycan genes in placental tissue of term pre-eclamptic patients.

AA Sequence

MTSSLLLAFLLLAPTTVATPRAGGQCPACGGPTLELESQRELLLDLAKRSILDKLHLTQRPTLNRPVSRA      1 - 70
ALRTALQHLHGVPQGALLEDNREQECEIISFAETGLSTINQTRLDFHFSSDRTAGDREVQQASLMFFVQL     71 - 140
PSNTTWTLKVRVLVLGPHNTNLTLATQYLLEVDASGWHQLPLGPEAQAACSQGHLTLELVLEGQVAQSSV    141 - 210
ILGGAAHRPFVAARVRVGGKHQIHRRGIDCQGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQC    211 - 280
PLHIAGMPGIAASFHTAVLNLLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACG    281 - 350
CS                                                                        351 - 352
//

Text Mined References (32)

PMID Year Title
25062451 2014 Effects of recombinant activins on steroidogenesis in human granulosa-lutein cells.
24599287 2014 Serum inhibin A and inhibin B levels in epithelial ovarian cancer patients.
23580013 2013 The inhibin-?C subunit is down-regulated, while inhibin-?E is up-regulated by interferon-?1a in Ishikawa carcinoma cell line.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23284751 2012 SNPs in the TGF-? signaling pathway are associated with increased risk of brain metastasis in patients with non-small-cell lung cancer.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
23180294 2013 Activin-?(c) reduces reproductive tumour progression and abolishes cancer-associated cachexia in inhibin-deficient mice.
21529351 2011 Inhibin secretion in women with the polycystic ovary syndrome before and after treatment with progesterone.
21117833 2011 Inhibin-betaC subunit expression in normal and pathological human placental tissues.
21092084 2010 Evidence of inhibin/activin subunit betaC and betaE synthesis in normal human endometrial tissue.
21063444 2011 Comprehensive fine mapping of chr12q12-14 and follow-up replication identify activin receptor 1B (ACVR1B) as a muscle strength gene.
20952735 Inhibin/activin-betaC subunit in human endometrial adenocarcinomas and HEC-1a adenocarcinoma cell line.
20884846 2010 Multiple genetic loci influence serum urate levels and their relationship with gout and cardiovascular disease risk factors.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20683603 2011 Inhibin/activin-betaC subunit does not represent a prognostic parameter in human endometrial cancer.
20458061 2010 Immunohistochemical labeling of the inhibin/activin betaC subunit in normal human placental tissue and chorionic carcinoma cell lines.
20012305 2010 Inhibin/activin-betaC and -betaE subunits in the Ishikawa human endometrial adenocarcinoma cell line.
19095948 2009 Activin C antagonizes activin A in vitro and overexpression leads to pathologies in vivo.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
18413775 2008 Genetic variation in the inhibin pathway and risk of testicular germ cell tumors.
16627954 2006 Analysis of the function of activin betaC subunit using recombinant protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12960042 2003 Activin betaC-subunit heterodimers provide a new mechanism of regulating activin levels in the prostate.
12651901 2003 Inhibin, activin, follistatin, activin receptors and beta-glycan gene expression in the placental tissue of patients with pre-eclampsia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11237224 2001 Mechanisms of inhibin signal transduction.
11134153 2000 Localization of activin beta(A)-, beta(B)-, and beta(C)-subunits in humanprostate and evidence for formation of new activin heterodimers of beta(C)-subunit.
9428386 1998 Inhibins, activins, and follistatins: expression of mRNAs and cellular localization in tissues from men with benign prostatic hyperplasia.
8838799 1996 Structure, chromosomal localization, and expression analysis of the mouse inhibin/activin beta C (Inhbc) gene.
7826378 1995 Cloning of a new member of the TGF-beta family: a putative new activin beta C chain.
1646080 1991 Expression cloning of an activin receptor, a predicted transmembrane serine kinase.