Property Summary

NCBI Gene PubMed Count 104
PubMed Score 25.38
PubTator Score 38.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
psoriasis -1.500 2.2e-08
ependymoma 1.500 2.2e-05
acute quadriplegic myopathy 1.046 1.3e-04
lung cancer 1.900 5.1e-05
breast carcinoma -1.700 5.9e-05
group 3 medulloblastoma 1.900 1.5e-03
Breast cancer -2.100 2.2e-04
Pick disease 1.100 4.3e-03
ductal carcinoma in situ -1.100 2.6e-02
invasive ductal carcinoma -1.400 9.5e-04
ovarian cancer 1.800 4.3e-04
pituitary cancer -1.700 1.2e-04
chronic rhinosinusitis -1.403 7.9e-03
cystic fibrosis and chronic rhinosinusit... -1.090 3.8e-02
facioscapulohumeral dystrophy -2.200 7.0e-04

Protein-protein Interaction (5)

Gene RIF (75)

PMID Text
26452703 The Sertoli cell hormones inhibin-B and anti Mullerian hormone have different patterns of secretion in prepubertal cryptorchid boys.
26313529 Pregnant Han Chinese women carrying the rs7579169 CC genotype and G-G-C haplotype are significantly more likely to develop pre-eclampsia, especially late-onset and multiparous cases.
25581422 inhibin B and anti-Mullerian hormone serum concentrations did not provide an additional diagnostic tool for male infertility
25557874 Activin-A and -B are abundantly expressed in mesothelioma tumor tissue.
25361680 We report here an original observation that activin-B is upregulated in the human idiopathic pulmonary fibrosis lung.
25343250 reduction of RhoA signaling by Activin B together with persistent Rac1 activity is a prerequisite for inducing an invasive phenotype in clear cell renal cell carcinoma.
25062451 Activin A, B, and AB have similar effects on steroidogenesis in human granulosa cells; in contrast, activin AC is not biologically active and does not act as a competitive antagonist.
24599287 Serum inhibin levels correlate with clinical characteristics and mortality in epithelial ovarian cancer patients.
24378873 Data show that expression of activin A and B was increased in many cancer cell lines.
24188875 Inhibin B production was decreased following recombinant human chorionic gonadotropin administration in both control and polycystic ovary syndrome women.
23836275 Serum inhibin B was significantly higher in breastfed adolescent males than in their peers.
23692058 inhibin B levels, but not FSH, are increased in primary hypothyroidism, which is consistent with a hypogonadotrophic hypogonadal state affecting the reproductive segment of the gonadotrophic axis
23664458 There are significant differences in serum inhibin B levels in patients with diminished ovarian reserve before and after supplementation with dehydroepiandrosterone (DHEA).
23423746 Data indicate that neither serum inhibin B nor follicle-stimulating hormone (FSH) is a suitable surrogate for determination of sperm concentration in a semen sample.
23349064 Inhibin B was measured in plasma samples obtained from 34 healthy male subjects selected on criteria typical for a phase I clinical trial across a wide age range.
22611157 The signaling pathway responsible for hepcidin up-regulation in the inflammatory context is still not understood completely. Activin B has an unexpected but crucial role in the induction of hepcidin by inflammation.
22432041 A genome-wide association study for preeclampsia in unrelated Australian individuals of Caucasian ancestry was performed to genotype single nucleotide polymorphisms the Inhibin, beta B gene on 2q14.2, in preeclampsia and normal pregnancy controls.
21938679 inhibin-betaB subunit appears not to be a useful prognostic marker regarding endometrioid adenocarcinomas.
21843890 Compared with antimullerian hormone (AMH), stimulated serum inhBB is a more accurate predictor of ovarian response in patients undergoing in vitro fertilization.
21529351 Data show that inhibin A levels were significantly lower in the PCOS group compared to the control group, and inhibin B levels were comparable in the two groups.
21475087 High inhibin beta B is associated with cervical intraepithelial neoplasia grades 1 and 2 compared to cervix uteri.
21285453 Inhibin B constitutes a reliable marker of Sertoli cell function as well as spermatogenesis, while the clinical significance of anti-Mullerian hormone in men with varicocele remains to be elucidated.
21168856 Inhibin B and antimullerian hormone have a role in gonadal function after treatment for medulloblastoma or posterior fossa ependymoma during childhood
20734064 Observational study of gene-disease association. (HuGE Navigator)
20713036 The aim of the present study is to investigate the effect of obesity on testicular function by evaluating reproductive hormones, inhibinB, insulin-like 3(INSL3), and leptin, in obese and non-obese adolescents according to pubertal Tanner stages.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20630504 A variant in the fibrillin-3 gene is associated with TGF-beta and inhibin B levels in women with polycystic ovary syndrome.
20200332 Observational study of gene-disease association. (HuGE Navigator)
20149358 Serum inhibin-b levels decrease nonlinearly during the daytime, and are positively correlated with sperm counts, but the predictive power is best when inhibin-b is low.
19589860 Inhibin B is more potent than inhibin A in suppressing FSH in vitro and in vivo, and this difference in bioactivity is not explained by its affinity to betaglycan or activin type II receptors.
19574343 Observational study of gene-disease association. (HuGE Navigator)
19539911 Bone morphogenetic protein-6 stimulates gene expression of inhibin/activin beta subunits in human granulosa cells.
19198021 Serum inhibin B and estradiol concentrations obtained shortly after Gn therapy may offer an accurate and early prediction of ovarian response.
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19061996 Antral follicle size influences serum inhibin B and FSH levels and alters their expected relationship with the number of antral follicles on day 3
18927237 Functional validation of activins and bone morphogenetic protein 11 as candidate novel muscle mass regulators.
18826955 Activin stimulates endogenous inhibin alpha- and betaB-subunit mRNA, protein, and proteolytic processing. Simultaneously, activin stimulated the proconvertase furin through a Smad2/3-dependent process.
18593767 There was no significant association of (log)inhibin B profiles with age at final menstrual period.
18555227 The degree of inhibin B increment during controlled ovarian stimulation provides a way for for predicting ovarian response to ovarian stimulation.
18423626 Women with polycystic ovary syndrome have high serum concentration of total inhibin but not of inhibin A or inhibin B.
18413775 Observational study of gene-disease association. (HuGE Navigator)
18381568 Expression of the beta-B subunit is related to decidualization and can be detected in the circulation as activin B.
17991484 Used monoclonal antibody to xenopus laevis Inhbb in ELISA for detection of human Inhbb.
17914098 Activin and estrogen crosstalk regulates transcription in human breast cancer cells.
17761145 Activin B is a potent inducer of Pdx1 as well as Shh in differentiating embryonic stem cell derived embryoid bodies
17681301 Ovarian follicle size did influence rates of local hormone production.
17666595 decreased levels of inhibin b are associated with hot flushes, aches, joint pain, stiffness and depressed mood in the stages of menopausal transition.
17628551 Granulosa cell production of inhibin B is reduced by pharmacologically induced increase in the intrafollicular androgen levels.
17525068 it is not clear that inhibin B does not seem to play any role in the mechanism of action of laparoscopic ovarian diathermy [letter]
17376219 Varicocele sclerotherapy improves inhibin B levels and seminal parameters.
17272393 glycosylation of Asn(302) of the alpha-subunit of inhibin A and B results in a decrease in bioactivity, and the effect on inhibin A, at least, is explained by its reduced affinity to betaglycan
16989826 The present findings showed that treatment with vaginal estroprogestinic decreases serum inhibin A and inhibin B levels, the follicular diameter
16935389 Follistatin was overexpressed while both activin subunits were downregulated in the majority of rat and human liver tumours
16758344 dimeric inhibins do not play a central role in the endocrinological imbalance observed in polycystic ovary syndrome
16728349 Preoperative serum inhibin B concentration could not reliably predict a response to varicocelectomy, but the increase in inhibin B levels after treatment might suggest an improvement in testicular function.
16670820 A significant down-regulation of inhibin-beta (B) subunit in extravillous trophoblast cells in IUGR syncytiotrophoblast cells was demonstrated.
16650820 INHBB expression was high in human adipocytes, reduced by weight loss and adipose tissue INHBB mRNA levels correlated to metabolic risk factors.
16650414 Higher levels of inhibin A and B are associated with oocyte presence but not with fertilization rates.
16423381 Hyperplastic tissue labelled more intensely than endometrium for the presence of INH-betaA and -betaB.
16195413 Discordant pattern of inhibin A and inhibin B during the rat estrous cycle is due to independent populations of antral follicles making inhibin B (small antral follicles) or inhibin A (large antral follicles).
16048795 conclude that obese women present less percentage variation of both inhibin A and B during the menstrual cycle, associated with a low frequency of ovulatory cycles
16024538 inhibin B may have a role in male fecundity
15910540 Exposure of the cells of Sertoli to excessive amounts of lead results in inappropriate inhibin B overproduction that may be involved in the impairment of spermatogenesis.
15757857 Regular increase of inhibin B(InhB) during puberty. In first phases of gonadal maturation, InhB and FSH correlate positively, while in mid-late stages relationship is inverse. In mid-puberty (G3-G4), serum InhB increases.
15562017 Ovulatory cycles were characterized by higher FSH and lower inhibin B leveels in hypergonadotropic hypogonadism or premature ovarian failure.
15551748 The expression of inhibin betaB by Sertoli cells is dependent on the coexistence of spermatogenic activity within these seminiferous tubules and is low in patients with Sertoli cell only syndrome.
15374731 Women with POF showed low levels of inhibin A and inhibin B, but not of activin A, whereas the levels of pro-alphaC were significantly higher than in postmenopausal women
15319819 Inhibin B pubertal surge is prominent signal of gonadal maturation in females as well as in males. Significantly higher in boys than in girls. Review.
15205401 Mutations in INHbetaB and INHbetaA genes are not associated with ovarian failure.
15070953 Gonads in anorexia nervosa with weight gain have low level of activity. Inhibin B is early marker of gonadal activity, and with weight gain, awakening of the reproductive function is gradual.
12857425 significant correlation between arterial and venous levels of inhibin A, inhibin B and activin A was found in umbilical cord artery and vein; findings suggest the placenta is the main source of inhibin B and the fetus of activin A in the umbilical cord
12651901 Results quantify the relative expression of inhibin alpha, inhibin/activin beta(A), beta(B), beta(C), follistatin, activin receptors and beta-glycan genes in placental tissue of term pre-eclamptic patients.
12493718 To determine which cell types in the testes may produce inhibin B, the localization of the two subunits of inhibin B was examined in adult testicular biopsies with normal spermatogenesis, spermatogenic arrest, or Sertoli cell only tubules.
12414903 synthesis by the endosalpinx

AA Sequence

MDGLPGRALGAACLLLLAAGWLGPEAWGSPTPPPTPAAPPPPPPPGSPGGSQDTCTSCGGFRRPEELGRV      1 - 70
DGDFLEAVKRHILSRLQMRGRPNITHAVPKAAMVTALRKLHAGKVREDGRVEIPHLDGHASPGADGQERV     71 - 140
SEIISFAETDGLASSRVRLYFFISNEGNQNLFVVQASLWLYLKLLPYVLEKGSRRKVRVKVYFQEQGHGD    141 - 210
RWNMVEKRVDLKRSGWHTFPLTEAIQALFERGERRLNLDVQCDSCQELAVVPVFVDPGEESHRPFVVVQA    211 - 280
RLGDSRHRIRKRGLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSF    281 - 350
HTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA                 351 - 407
//

Text Mined References (105)

PMID Year Title
26452703 2016 The Sertoli cell hormones inhibin-B and anti Müllerian hormone have different patterns of secretion in prepubertal cryptorchid boys.
26313529 2015 Single nucleotide polymorphisms near the inhibin beta B gene on 2q14 are associated with pre-eclampsia in Han Chinese women.
25581422 2015 Inhibin B is lower and anti-Müllerian hormone is similar in serum of men with spinal cord injuries compared to controls.
25557874 2015 Overexpression of activin-A and -B in malignant mesothelioma - attenuated Smad3 signaling responses and ERK activation promote cell migration and invasive growth.
25528498 2015 Evaluating the ovarian cancer gonadotropin hypothesis: a candidate gene study.
25361680 2014 Upregulation of activin-B and follistatin in pulmonary fibrosis - a translational study using human biopsies and a specific inhibitor in mouse fibrosis models.
25343250 2014 Activin B antagonizes RhoA signaling to stimulate mesenchymal morphology and invasiveness of clear cell renal cell carcinomas.
25062451 2014 Effects of recombinant activins on steroidogenesis in human granulosa-lutein cells.
24599287 2014 Serum inhibin A and inhibin B levels in epithelial ovarian cancer patients.
24378873 2014 Elevated expression of activins promotes muscle wasting and cachexia.
24188875 2014 Decreased inhibin B responses following recombinant human chorionic gonadotropin administration in normal women and women with polycystic ovary syndrome.
23836275 2013 Association of breastfeeding with higher serum inhibin B level at adolescence.
23692058 2013 Inhibin B levels in hypothyroid males.
23664458 2013 Dehydroepiandrosterone supplementation improves predictive markers for diminished ovarian reserve: serum AMH, inhibin B and antral follicle count.
23423746 2013 Lack of specificity of plasma concentrations of inhibin B and follicle-stimulating hormone for identification of azoospermic survivors of childhood cancer: a report from the St Jude lifetime cohort study.
23349064 2013 Inhibin B in plasma samples from male volunteer panel selected for health but not fertility: sources of variability.
23326517 2013 Insights into the genetic architecture of early stage age-related macular degeneration: a genome-wide association study meta-analysis.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
22611157 2012 Induction of activin B by inflammatory stimuli up-regulates expression of the iron-regulatory peptide hepcidin through Smad1/5/8 signaling.
22432041 2012 Genome-wide association scan identifies a risk locus for preeclampsia on 2q14, near the inhibin, beta B gene.
21938679 2011 Inhibin beta B: a useful tumor marker in uterine endometrioid adenocarcinomas?
21843890 2011 Comparisons of inhibin B versus antimüllerian hormone in poor ovarian responders undergoing in vitro fertilization.
21552555 2011 A genome-wide association study on obesity and obesity-related traits.
21529351 2011 Inhibin secretion in women with the polycystic ovary syndrome before and after treatment with progesterone.
21475087 2010 Immunolabeling of the inhibin-?A and -?B subunit in normal and malignant human cervical tissue and cervical cancer cell lines.
21285453 2011 Inhibin B and anti-Müllerian hormone in spermatic vein of subfertile men with varicocele.
21168856 2011 Inhibin B and anti-Müllerian hormone as markers of gonadal function after treatment for medulloblastoma or posterior fossa ependymoma during childhood.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20713036 2010 The effect of obesity on testicular function by insulin-like factor 3, inhibin B, and leptin concentrations in obese adolescents according to pubertal stages.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20634197 2010 Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium.
20630504 2010 A variant in the fibrillin-3 gene is associated with TGF-? and inhibin B levels in women with polycystic ovary syndrome.
20200332 2010 Family-based analysis of candidate genes for polycystic ovary syndrome.
20149358 2010 Serum inhibin-b in fertile men is strongly correlated with low but not high sperm counts: a coordinated study of 1,797 European and US men.
19589860 2009 Inhibin B is a more potent suppressor of rat follicle-stimulating hormone release than inhibin a in vitro and in vivo.
19574343 2009 Quantitative trait loci predicting circulating sex steroid hormones in men from the NCI-Breast and Prostate Cancer Cohort Consortium (BPC3).
19539911 2009 Bone morphogenetic protein-6 stimulates gene expression of follicle-stimulating hormone receptor, inhibin/activin beta subunits, and anti-Müllerian hormone in human granulosa cells.
19198021 2009 Dynamic measurements of serum inhibin B and estradiol: a predictive evaluation of ovarian response to gonadotrophin stimulation in the early stage of IVF treatment.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19061996 2010 Early follicle development alters the relationship between antral follicle counts and inhibin B and follicle-stimulating hormone levels on cycle day 3.
18927237 2008 Proteomic identification and functional validation of activins and bone morphogenetic protein 11 as candidate novel muscle mass regulators.
18826955 2008 An activin/furin regulatory loop modulates the processing and secretion of inhibin alpha- and betaB-subunit dimers in pituitary gonadotrope cells.
18593767 2008 Anti-mullerian hormone and inhibin B in the definition of ovarian aging and the menopause transition.
18555227 2009 Serum inhibin B during controlled ovarian hyperstimulation: an additional criterion for deciding whether to proceed with egg retrieval.
18423626 2008 High serum concentration of total inhibin in polycystic ovary syndrome.
18413775 2008 Genetic variation in the inhibin pathway and risk of testicular germ cell tumors.
18381568 2008 Endometrial inhibin/activin beta-B subunit expression is related to decidualization and is reduced in tubal ectopic pregnancy.
17991484 2008 Development of a new antibody to the human inhibin/activin betaB subunit and its application to improved inhibin B ELISAs.
17914098 2007 Activin and estrogen crosstalk regulates transcription in human breast cancer cells.
17761145 2007 Activin B mediated induction of Pdx1 in human embryonic stem cell derived embryoid bodies.
17681301 2008 Human granulosa-lutein cell in vitro production of progesterone, inhibin A, inhibin B, and activin A are dependent on follicular size and not the presence of the oocyte.
17666595 2007 Symptoms associated with menopausal transition and reproductive hormones in midlife women.
17628551 2008 Increased intrafollicular androgen levels affect human granulosa cell secretion of anti-Müllerian hormone and inhibin-B.
17525068 2007 Effect of laparoscopic ovarian diathermy on circulating inhibin B in women with anovulatory polycystic ovary syndrome.
17376219 2007 Varicocele sclerotherapy improves serum inhibin B levels and seminal parameters.
17272393 2007 Inhibin A and B in vitro bioactivities are modified by their degree of glycosylation and their affinities to betaglycan.
16989826 2006 Vaginally administered estroprogestinic decreases serum inhibin A and inhibin B levels and reduces endometrial thickness.
16935389 2006 Deregulation of the activin/follistatin system in hepatocarcinogenesis.
16758344 2006 Luteal-phase inhibin A and follicular-phase inhibin B levels are not characteristic of patients with an elevated LH-to-FSH ratio.
16728349 Inhibin B levels in peripheral vein do not correlate with inhibin B levels in the spermatic vein in adolescents with varicocele.
16670820 2006 Expression of inhibin/activin subunits alpha (-alpha), beta A (-beta (A)) and beta B (-beta (B)) in placental tissue of normal and intrauterine growth restricted (IUGR) pregnancies.
16650820 2006 The expression of inhibin beta B is high in human adipocytes, reduced by weight loss, and correlates to factors implicated in metabolic disease.
16650414 2006 Follicular fluid levels of inhibin A, inhibin B, and activin A levels reflect changes in follicle size but are not independent markers of the oocyte's ability to fertilize.
16423381 2006 Inhibin/activin subunits beta-A (-betaA) and beta-B (-betaB) are differentially localised in normal, hyperplastic and malignant human endometrial tissue.
16195413 2006 Follicle size class contributes to distinct secretion patterns of inhibin isoforms during the rat estrous cycle.
16048795 2005 Abnormal inhibin A and inhibin B secretion in obese women with and without insulin resistance.
16024538 2005 Fecundability according to male serum inhibin B--a prospective study among first pregnancy planners.
15910540 2005 Is inhibin B involved in the toxic effect of lead on male reproduction?
15851553 2005 The lacrimal gland transcriptome is an unusually rich source of rare and poorly characterized gene transcripts.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15757857 2005 Changes in serum inhibin B during normal male puberty.
15562017 2005 Relationship of estradiol and inhibin to the follicle-stimulating hormone variability in hypergonadotropic hypogonadism or premature ovarian failure.
15551748 Differential regulation of inhibin subunits by germ cells in human testes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15374731 2004 Serum inhibin A, inhibin B, pro-alphaC, and activin A levels in women with idiopathic premature ovarian failure.
15319819 2004 Inhibin B in pubertal development and pubertal disorders.
15205401 2004 Mutational analysis of the mature peptide region of inhibin genes in Indian women with ovarian failure.
15196700 2004 Activin isoforms signal through type I receptor serine/threonine kinase ALK7.
15070953 2004 Inhibin B: a potential marker of gonadal activity in patients with anorexia nervosa during weight recovery.
12857425 2003 Inhibin A, inhibin B and activin A concentrations in umbilical cord artery and vein.
12790766 2003 Inhibin B, follicle stimulating hormone, luteinizing hormone, and estradiol and their relationship to the regulation of follicle development in girls during childhood and puberty.
12697670 2003 Differential binding and neutralization of activins A and B by follistatin and follistatin like-3 (FSTL-3/FSRP/FLRG).
12651901 2003 Inhibin, activin, follistatin, activin receptors and beta-glycan gene expression in the placental tissue of patients with pre-eclampsia.
12571168 2003 Serum anti-Müllerian hormone is more strongly related to ovarian follicular status than serum inhibin B, estradiol, FSH and LH on day 3.
12543931 2002 Toward a human blood serum proteome: analysis by multidimensional separation coupled with mass spectrometry.
12493718 2003 Immunolocalization of inhibin and activin alpha and betaB subunits and expression of corresponding messenger RNAs in the human adult testis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12456957 2002 The role of activin a in regulation of hemopoiesis.
12419948 2002 Activins A, AB, and B inhibit hepatocyte growth factor synthesis by MRC-5 human lung fibroblasts.
12414903 2002 Production of activins by the human endosalpinx.
12032389 2002 The physiology and pathophysiology of inhibin, activin and follistatin in female reproduction.
11344232 2001 Inhibin/activin betaB-subunit expression in pheochromocytomas favors benign diagnosis.
11266516 2001 Modulation of activin signal transduction by inhibin B and inhibin-binding protein (INhBP).
11134153 2000 Localization of activin beta(A)-, beta(B)-, and beta(C)-subunits in humanprostate and evidence for formation of new activin heterodimers of beta(C)-subunit.
10320815 1999 A novel role of activin in inflammation and repair.
9202237 1997 Inhibin interferes with activin signaling at the level of the activin receptor complex in Chinese hamster ovary cells.
3754442 1986 Structure of two human ovarian inhibins.
3345731 1988 Inhibin: definition and nomenclature, including related substances.
3122219 1987 Inhibins and activins: chemical properties and biological activity.
2767687 1989 Mapping of genes for inhibin subunits alpha, beta A, and beta B on human and mouse chromosomes and studies of jsd mice.
2739657 1989 Characterization and regulation of testicular inhibin beta-subunit mRNA.
2575216 1989 Activin B: precursor sequences, genomic structure and in vitro activities.
2364091 1990 Purification and characterization of recombinant human activin B.
1646080 1991 Expression cloning of an activin receptor, a predicted transmembrane serine kinase.