Property Summary

NCBI Gene PubMed Count 230
PubMed Score 65.59
PubTator Score 157.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
permanent atrial fibrillation -1.100 2.5e-02
group 4 medulloblastoma -2.600 4.1e-04
cystic fibrosis 1.300 1.8e-02
primary pancreatic ductal adenocarcinoma 4.751 5.9e-05
tuberculosis -4.600 4.9e-06
X-linked cerebral adrenoleukodystrophy 3.000 2.2e-02
colon cancer 4.500 1.7e-04
lung cancer -1.500 7.6e-05
pancreatic cancer 4.500 8.1e-04
breast carcinoma 2.600 1.3e-36
Breast cancer 6.300 2.2e-02
interstitial cystitis 4.100 3.7e-04
lung adenocarcinoma -1.100 1.4e-06
pilocytic astrocytoma 1.700 9.6e-03
primary Sjogren syndrome -1.400 1.5e-02
invasive ductal carcinoma 3.686 1.4e-03
nasopharyngeal carcinoma 2.500 3.9e-05
psoriasis -1.200 1.0e-04
lung carcinoma -1.100 4.8e-05
gastric carcinoma 4.800 1.3e-02
ductal carcinoma in situ 2.900 9.8e-05
ulcerative colitis 4.500 1.1e-04
ovarian cancer 2.800 3.2e-03
head and neck cancer -1.500 4.8e-02

Protein-protein Interaction (6)

Gene RIF (177)

PMID Text
26563344 Data show that dedifferentiated chondrocytes can be redifferentiated following treatment with the chimeric erythroid differentiation factor (activin A)/bone morphogenetic protein 2 (BMP2) ligand AB235.
26447543 we show a role for autocrine Activin signaling in the regulation of colony formation, cell migration and invasion in Barrett's tumorigenesis.
26415587 Study shows that INHBA and FST are induced by seminal fluid in cervical tissues and thus, may contribute to regulation of the post-coital response in women.
26317418 Overexpression of activin A in OSCCs, which is controlled by downregulation of miR-143/miR-145 cluster, regulates apoptosis, proliferation and invasiveness, and it is clinically correlated with lymph node metastasis and poor survival.
26298390 Our study uncovers the PITX2-induced expression of TGFB1/2/3 as well as INHBA genes (p < 0.01) followed by SMAD2/3-dependent TGF-b signalling pathway in ovarian cancer cells
26096938 Inhibin betaA is translationally regulated by TGFbeta via hnRNP E1.
26047946 Activin A inhibited signaling by BMP-6 and BMP-9 by competing for type 2 receptors ACVR2A and ACVR2B.
25833251 able to restore glucose-stimulated insulin secretion in islets from type 2 diabetic donors
25796148 Low activin-A expression was correlated with the occurrence, development, metastasis and malignant degree of lung adenocarcinoma.
25751105 our study suggests that increased circulating concentrations of ActA may contribute to the development of cachexia in cancer patients.
25729977 Increased serum level of activin A indicates its role in the pathogenesis of asthma, particularly in underweight and overweight patients.
25659497 Data suggest that an SNP in promoter region of ACVR2A (activin A receptor type IIA; rs1424954, the pre-eclampsia susceptibility allele) down-regulates signal transduction in trophoblasts in response to excess activin-A (as seen in pre-eclampsia).
25634576 Data suggest that activin A [plus bone morphogenic protein 4 (BMP4)] strongly stimulates germ cell differentiation potential of human embryonic stem cells; this stimulation appear to depend on gene expression regulation by activin A.
25565002 changes in Follistatin levels during pregnancy contribute to the control of the activin A system
25557874 Activin-A and -B are abundantly expressed in mesothelioma tumor tissue.
25488476 INHBA overexpression implies adverse clinical outcomes for urothelial carcinoma, justifying it is a potential prognostic biomarker and a novel therapeutic target in UC
25449777 High activin A signal promotes cancer progression and is involved in cachexia in a subset of pancreatic cancer.
25200295 Data suggest that activin A (dimer of INHBA), especially in lateral hypothalamus, plays role in neuronal sensing of free amino acids, appetite regulation, and neuronal plasticity. [REVIEW]
25114097 Endothelial cells initiate a smooth muscle cell differentiation program in adjacent adipose stromal cells via induction activin A expression.
25084052 Activin A is an anti-lymphangiogenic factor, but because of its pleiotropic effects on cell mobility it appears not suitable as a pharmacological target.
25062451 Activin A, B, and AB have similar effects on steroidogenesis in human granulosa cells; in contrast, activin AC is not biologically active and does not act as a competitive antagonist.
24928494 Activin A promoted chemotaxis, migration and proliferation of human periodontal ligament cells, and caused an increase in fibroblastic differentiation of these cells while down-regulating their osteoblastic differentiation.
24916766 overexpression of INHBA in mesenchymal cells increases colony formation potential of epithelial cells, suggesting that it contributes to the dynamic reciprocity between breast mesenchymal and epithelial cells.
24778035 Overexpression of the INHBA gene is considered a useful independent predictor of outcomes in patients with gastric cancer after curative surgery.
24599287 Serum inhibin levels correlate with clinical characteristics and mortality in epithelial ovarian cancer patients.
24395917 Activin A, produced during NK-DC interactions, represents a relevant negative feedback mechanism that might function to prevent excessive immune activation by DCs.
24378873 Data show that expression of activin A and B was increased in many cancer cell lines.
24336657 IFN-gamma modulates NF-kappaB/c-Jun to antagonize activin A-mediated NF-E2 transcriptional activity on erythroid cell globin gene expression
24302632 We identified an unreported germline mutation of the INHA gene encoding the alpha-subunit, the partner of the betaA-subunit. This mutation also alters the secreted activin/inhibin ratio, by disrupting both inhibin A and inhibin B biosynthesis.
24227781 Recombinant human activin A increases mature mast cell numbers in vivo in mouse skin via attraction of mast cell progenitors from bone marrow.
24204752 Follistatin, by its ability to neutralize the actions of activin A may be of value as an antifibrotic for radiation induced fibrosis.
24168163 expression of erythroid differentiation regulator 1 was negatively correlated with the malignant potential in various skin tumors.
24162774 HIV-1 gp120 upregulates the expression of inhibin, beta A (INHBA) in human B cells
24139759 the Activin/ALK4 pathway directly recruits PTP1B and stimulates its release from the endoplasmic reticulum through ALK4-mediated cleavage.
24134550 Circulating activin A levels are associated with impaired myocardial glucose metabolism and high left ventricular mass/volume ratio in men with uncomplicated type 2 diabetes, reflecting a potential detrimental role in early human diabetic cardiomyopathy.
24107149 Maternal serum inhibin-A levels were significantly higher in pregnancies with fetal Hb Bart's disease.
24085226 The present study suggests that INHBA is useful as a predictive marker for prognosis in colorectal cancer patients.
23898208 HIV-1 gp120 upregulates the expression of inhibin, beta A (INHBA) in human B cells
23831638 retinoid signalling can potently suppress activin-induced proliferation by antagonising G1 phase progression and entry into the cell cycle.
23812417 Activin A released from EAT-T2D inhibits insulin action via the induction of miR-143 in cardiomyocytes
23808611 Urine Activin A in preterm infants who developed intraventricular hemorrhage was significantly higher than in controls at all monitoring time-points, increasing progressively from first urination to 24 h when it reached the highest peak.
23781072 Activin A suppresses osteoblast mineralization capacity by altering extracellular matrix composition and impairing matrix vesicle production.
23589129 Mineralization induction by 1alpha,25(OH)2 D3 may actually be controlled via interplay with activin A and osteocalcin.
23383108 HIV-1 gp120 upregulates the expression of inhibin, beta A (INHBA) in human B cells
23205865 Screening by maternal characteristics and activin-A at 30-33 weeks identifies half of the pregnancies that will subsequently develop preeclampsia.
23024260 Activin A stimulates AKR1C3 expression and growth in human prostate cancer
22845186 The study shows the involvement of activin A pathway in preterm premature rupture of the membranes associated with acute chorioamnionitis.
22685232 Plasma and placental productions of Activin A were significantly higher in preeclamptic patients when compared with normal pregnant subjects in a Chinese Han population
22579070 The overarching hypothesis is that insensitivity to the growth inhibitory effects of activin A is an acquired capability in prostate cancer progression.
22549017 The activin A signals via SMAD proteins, but not TAK1 or p38, to regulate murine and ovine Fshb transcription in gonadotrope-like cells.
22548442 Activin A promotes the induction of mesoderm, as indicated by the upregulation of Brachyury expression.
22439617 Activin A levels were significantly higher in hypoxic than nonhypoxic newborns and in male newborns.
22425195 The pathological expression of activin beta A, iNOS and MUC1 by fallopian tubes bearing an ectopic pregnancy is not involved in the determination of implantation site.
22416010 The present study demonstrated that serum activin A is not significantly altered in peritoneal or deep infiltrating endometriosis and has limited diagnostic accuracy in the diagnosis of ovarian endometrioma.
22296042 Inhibin and activin beta subunits aree clearly demonstrable throughout the adult human hypothalamus and basal forebrain.
22234949 In patients with T2DM, increased activin A may reflect chronic underlying pathophysiological processes involved in development of cardiovascular disease.
22161160 High Activin-A levels were found in bronchoalveolar lavage (BAL) samples from patients with acute respiratory distress syndrome (ARDS).
21992678 Human amniotic fluid activin-A and inhibin-A are involved in biological processes linked to intra-amniotic infection/inflammation-induced preterm birth.
21952245 Activin-A was identified as strongly secreted by mesenchymal cells from control and T21 mesenchymal cells. Recombinant activin-A stimulated T21 trophoblast fusion
21846490 Activin A in the follicular fluid is biologically inactivated by a more than ten times surplus of follistatin.
21767104 Activin A in maternal and fetal biological fluids is increased after SSRI administration in the third trimester of pregnancy.
21640344 Activin-A appears to promote endometriosis by stimulating interleukin-6 and protease-activated receptor-2 mRNA expression and increasing the proliferation of endometrioma stromal cells.
21576276 results indicate that the coding regions of INHBA, SFRP4 and HOXA10 do not harbour mutations responsible for linkage to endometriosis in the families studied
21529351 Data show that inhibin A levels were significantly lower in the PCOS group compared to the control group, and inhibin B levels were comparable in the two groups.
21475087 High inhibin beta A is associated with cervical intraepithelial neoplasia grade 3 compared to cervical intraepithelial neoplasia grades 1 and 2.
21464440 Study found a significant association between activin A and newly detected abnormal glucose regulation in patients with acute myocardial infarction.
21222045 analysis of candidate genes revealed four genes that influence fertility: CGB/LHB gene cluster (p = 0.0036), FSHR (p = 0.023), FST (p = 0.023), and INHB; none of the independent SNPs in these genes predicted mortality
21132402 INHBA may be a poor survival indicator of gastric cancer
20926007 Protein levels of activin A and follistatin were assessed in glioblastoma and normal brain tissues in this study
20734064 Observational study of gene-disease association. (HuGE Navigator)
20720391 Elevated plasma activin A levels are associated with the presence of carcinoid heart disease.
20704626 Report serum/synovial fluid activin A and inhibin A levels in rheumatoid arthritis, systemic lupus erythematosus and knee ostoearthritis.
20660033 GDF9 attenuates the suppressive effects of activin A on StAR expression and progesterone production by increasing the expression of inhibin B, which acts as an activin A competitor.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20610541 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20309641 Overexpression of activin A is associated with oral squamous cell carcinoma.
20226172 activin A signal is transduced through the activin A type 1 receptor, ALK4, and transactivates several TGF-beta target genes in a SMAD-independent manner.
20203128 results are consistent with a role for activin in maintaining oocyte granulosa cell interactions due to increased peripheral granulosa cell adhesion to the basement membrane and retention of adhesion at the surface of the zona pellucida.
20200332 Observational study of gene-disease association. (HuGE Navigator)
20194748 Activin A, a TGF-beta family member, is a therapeutically amenable target exploited by multiple myeloma (MM) to alter its microenvironmental niche favoring osteolysis.
20043075 down-regulated KLF4, CHGA, GPX3, SST and LIPF, together with up-regulated SERPINH1, THY1 and INHBA is an 8-gene signature for gastric cancer
20036850 Activin A increased in asphyxiated full-term newborns with hypoxic ischemic encephalopathy before the appearance of related signs.
20028875 in ductal carcinoma in situ lesions, high COX-2 expression is associated with high gammaH2AX, TRF2, activin A, and telomere malfunction
19885849 roles of activin A in Human embryonic stem cell proliferation and differentiation were found.
19733294 Both TGF-beta and activin signaling pathways are activated on allergen provocation in asthma. Activin-A may contribute to resolution of inflammation.
19661148 Synthesis of activin and TGFB-signaling modulators may be affected by spermatogenic disruption and altered hormone levels in the testis.
19641514 Activin A is not a clinically useful marker of intrauterine infection in women with preterm prelabour rupture of membranes
19615428 The gonadally derived Inhibins are important regulators of locally produced osteotrophic factors.
19574343 Observational study of gene-disease association. (HuGE Navigator)
19539911 Bone morphogenetic protein-6 stimulates gene expression of inhibin/activin beta subunits in human granulosa cells.
19386982 Activin A, activin receptor type II, nodal, and cripto mRNA are expressed by eutopic and ectopic endometrium in women with ovarian endometriosis.
19383344 up-regulation in human colorectal cancer is correlated with upregulation of the TIMP-1 transcript
19324968 A novel role for FOXL2 in activin A-regulated Fshb transcription.
19308293 INHBA is overexpressed in lung adenocarcinoma relative to controls.
19257827 activation of the AR through Smads is required for activin A-promoted prostate cancer cell migration to bone matrix, thereby promoting the bone metastatic phenotype
19240652 INHBA overexpression promotes cell proliferation and may be epigenetically regulated in esophageal adenocarcinoma.
19200970 Activin A is secreted into uterine lumen; the levels in endometrial washing fluids were higher in women who subsequently became pregnant after IUI, so its measurement may be useful in predicting successful implantation.
19196915 Our findings in both clinical and experimental studies suggest a role for activin A in the development of various types of pulmonary hypertension
19158274 Activin B is a key mediator of VHL/HIF-induced transformation in renal cell carcinomas.
19141859 A novel immune regulatory role of activin-A during DC-mediated NK-cell regulation.
19128983 Results indicate that adiponectin upregulates monocytic activin A release via the p38 MAPK pathway.
19095948 activin-beta(C) is an antagonist of activin A
19091310 Data suggest that activin A can down-regulate inflammatory mediator production and phagocytosis of LPS-activated macrophages via suppressing CD14 expression, and may influence the presentation of exogenous antigens via inhibiting MHC II expression.
19086053 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19028479 The serum activin A level increased in acute myocardial infarction positively correlated with peak creatine kinase and CK-MB levels which are measures of infarction size.
19027859 Synthesis, purification and bioactivity of recombinant human activin A expressed in the yeast Pichia pastoris
18854336 Adenoviral activin A expression prevents vein graft intimal hyperplasia in a rat model.
18768470 analysis of the structure of the FSTL3.activin A complex
18719101 synergistic effect of Wnt3a and ActivinA on hESCs differentiation into hepatic-like cells
18695873 activin A may modulate the expression of MMP-7 via AP-1
18608101 Observational study of gene-disease association. (HuGE Navigator)
18600473 TGF-beta1 or activin A but not BMP-2 significantly decreased significantly decreased melanin content and expression of Tyrosinase and Tyrp-1 in the absence of alpha-MSH in melanoma cells
18535106 Differential antagonism of activin, myostatin and growth and differentiation factor 11 by wild-type and mutant follistatin.
18460206 ActA interferes with selected aspects of DC maturation & may help prevent activation of allogenic T-cells by the embryo. This may promote the generation of tolerance-inducing DCs.
18450971 Activin A may mediate ovarian oncogenesis by activating Akt and repressing GSK to stimulate cellular proliferation.
18423626 Women with polycystic ovary syndrome have high serum concentration of total inhibin but not of inhibin A or inhibin B.
18413775 Observational study of gene-disease association. (HuGE Navigator)
18381582 Concentration of anti-Mullerian hormone and inhibin-B in relation to steroids and age in follicular fluid from small antral human follicles.
18359784 Activin A increases invasiveness of endometrial cells in an in vitro model of human peritoneum.
18353928 A dual role of activin A in regulating immunoglobulin production of B cells.
18319260 These results reveal a key role of GLI2 in activation of the activin/BMP antagonist FST in response to hedgehog (HH) signaling.
18299275 analysis of the production and function of activin A in human dendritic cells
18166170 The effects of activin on germ cells are indirect and include mediation by the kit ligand/c-Kit pathway, rather than being an autocrine germ cell effect.
18156495 These findings establish an immune-regulatory role for activin-A in dendritic cells, highlighting the potential of antagonizing activin-A signaling in vivo to enhance vaccine immunogenicity.
18089557 Cripto facilitates Nodal signaling and inhibits activin signaling by forming receptor complexes with these ligands that are structurally and functionally similar.
18077449 new hypoxia-inducible and SOX9-regulated genes, Gdf10 and Chm-I. In addition, Mig6 and InhbA were induced by hypoxia, predominantly via HIF-2alpha
18001154 Inhibin/activin BA subunit, follistatin, and activin receptor proteins and mRNAs are present in the human fetal palate.
17968943 Activin A is potentially an anticatabolic molecule in articular cartilage
17954979 A peptide corresponding to the N-terminal region of human follicle-stimulating hormone (FSH)-binding inhibitor (FSHBI/ovarian follicular fluid peptide) shows FSHBI inhibitory activity in rat ovarian granulosa cell cultures.
17929017 bFGF does not directly act on p38 nor on the mRNA expression levels of activin receptors but inhibit activin A activation of p38 upstream of p38 in K562 cells.
17909904 Overexpression of Activin a causes cancer cell aggressiveness in esophageal squamous cell carcinoma
17681301 Ovarian follicle size did influence rates of local hormone production.
17478557 Activin-A is an excellent candidate for an effector molecule in human luteolysis whose paracrine action is inhibited during maternal recognition of pregnancy
17462637 Serum AMH and inhibin B are significantly lower in the men with nonobstructive azoospermia compared to the controls.
17436000 Activin A suppresses interleukin-1-induced matrix metalloproteinase 3 secretion in human chondrosarcoma cells
17384470 FGF-2 and activin A enhance their signals each other in bovine aortic endothelial cells, and endogenous activin A is critical for FGF-2-induced capillary formation.
17204604 Phosphatidylinositol 3-kinase antagonizes the ability of human embryonic stem cells to differentiate in response to transforming growth factor beta family members such as Activin A
16988001 Activin A has opposite effects on glucagon and arx gene expression in alpha-cells compared with beta-cells, a finding that may have relevance during pancreatic endocrine lineage specification and physiological function of the adult islets
16820918 Activin has autocrine roles in tumor growth of ovarian clear cell adenocarcinoma cells.
16643884 When cultured with the mesonephros, Wolffian ducts formed ectopic buds in response to GDNF; inhibition of GDNF-induced budding by activin A led to inhibition of cell proliferation, & decrease of both Pax2 expression and PI3- & MAP kinase phosphorylation
16423381 Hyperplastic tissue labelled more intensely than endometrium for the presence of INH-betaA and -betaB.
16081641 Activation of TAK1 (and probably p38-MAPK), but not Smad3, is necessary for triggering induction of oFSHbeta by activin.
15950648 Activin A and inhibin A may be used as markers to predict pregnancies that are likely to miscarry.
15737465 activin A inhibits adipogenesis via affecting the transcriptional factor cascade upstream of PPARgamma expression
15580313 enhanced activin A expression suppresses proliferation and colony formation of human neuroblastoma cell
15451571 review article of gene expression of inhibin beta A in normal breast carcinoma, fibroadenoma, and normal mammary tissue
15374731 Women with POF showed low levels of inhibin A and inhibin B, but not of activin A, whereas the levels of pro-alphaC were significantly higher than in postmenopausal women
15292256 may be an anabolic factor in cartilage
15205401 Observational study of gene-disease association. (HuGE Navigator)
15205401 Mutations in INHbetaB and INHbetaA genes are not associated with ovarian failure.
15188178 activin A is a novel stimulus of vascular endothelial growth factor gene expression in hepatocellular carcinoma
15123686 activin signaling via type II receptors requires a specific sequence for ALK4 binding
15123352 Activin A increased the expression of VEGF receptors in cultured sinusoidal endothelial cells.
15070957 Testosterone secretion is impaired in infants with Klinefelter syndrome.
15031321 the smad pathway and the tumor suppressor menin are key regulators of activin effects on PRL and Pit-1 expression, as well as on cell growth inhibition
14993131 Activin A markedly increased gene expression of mediators involved in infarction healing and myocardial remodeling in neonatal rat cardiomyocytes.
14738881 Data indicate that activin A and activin receptors IIA and IIB may be involved in the regulation of germ cell proliferation in the human ovary during the period leading up to primordial follicle formation.
14671321 DLX1 blocks multiple signals from TGF-beta superfamily cytokines such as activin A, TGF-beta1, and BMP-4, including differentiation of a hematopoietic cell line by activin A
14671202 Peripheral blood monoCYTES and endothelium, activated by TNFalpha, could be extraplacental sources of activin A in preeclampsia. May have role in mechanisms underlying endothelium dysfunction.
14613548 activin promoted ovine preantral follicle & oocyte growth in vitro, but did not accelerate follicle differentiation; these results support a paracrine role for activin A during early oocyte & follicular development
12877256 Serum inhibin B is an effective marker of follicular development in infertile women undergoing induction of superovulation, and may represent a further marker for ovarian follicular capacity.
12721183 Proportions of precursor inhibin B and alpha-subunit forms in the circulation are unchanged in men with spermatogenic disorders indicating there is no alteration of the Sertoli cell inhibin secretory pattern.
12702211 Activin-A modulates ActRI mRNA levels in human trophoblast cells.
12665510 Activin A promotes Smad2 phosphorylation and its nuclear translocation. As an immediate response to activin A, Smad2 was modified by phosphorylation within 2 hours.
12651901 Results quantify the relative expression of inhibin alpha, inhibin/activin beta(A), beta(B), beta(C), follistatin, activin receptors and beta-glycan genes in placental tissue of term pre-eclamptic patients.
12587530 data suggest that the increased placental expression of inhibin subunit mRNAs is part of the mechanism leading to increased serum activin A and inhibin A levels
12524226 Activin A induces cardiac ankyrin repeat protein (CARP) in cultured intimal smooth muscle cells in a dose-dependent way.
12414903 synthesis by the endosalpinx
12399529 Seminal inhibin B levels were higher in normal men than in men after vasectomy and in men with azoospermia.
12161551 Activin A promotes human endometrial stromal cell decidualization in vitro.
12149426 Activin A is potently induced in the bone marrow and may play a role in the suppression of inflammatory or immune processes.
12088879 Activin was secreted by both endometrial adenocarcinoma cell lines. Activin showed a weak, but significant, mitogenic effect on HEC-50 cells without modifications in Bax and Bcl-2. Activin is a regulator of endometrial cancer cell growth.
11969340 distribution in gestational tissues across human pregnancy and during labour

AA Sequence

MPLLWLRGFLLASCWIIVRSSPTPGSEGHSAAPDCPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKK      1 - 70
RPDVTQPVPKAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQTSEIITFAESGTARKTLHFEI     71 - 140
SKEGSDLSVVERAEVWLFLKVPKANRTRTKVTIRLFQQQKHPQGSLDTGEEAEEVGLKGERSELLLSEKV    141 - 210
VDARKSTWHVFPVSSSIQRLLDQGKSSLDVRIACEQCQESGASLVLLGKKKKKEEEGEGKKKGGGEGGAG    211 - 280
ADEEKEQSHRPFLMLQARQSEDHPHRRRRRGLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYC    281 - 350
EGECPSHIAGTSGSSLSFHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIV    351 - 420
EECGCS                                                                    421 - 426
//

Text Mined References (230)

PMID Year Title
26563344 2015 Activin A/BMP2 chimera AB235 drives efficient redifferentiation of long term cultured autologous chondrocytes.
26447543 2015 Activin a signaling regulates cell invasion and proliferation in esophageal adenocarcinoma.
26415587 2015 Seminal fluid factors regulate activin A and follistatin synthesis in female cervical epithelial cells.
26317418 2015 Low miR-143/miR-145 Cluster Levels Induce Activin A Overexpression in Oral Squamous Cell Carcinomas, Which Contributes to Poor Prognosis.
26298390 2015 Invasion of ovarian cancer cells is induced byPITX2-mediated activation of TGF-? and Activin-A.
26096938 2016 Translational regulation of inhibin ?A by TGF? via the RNA-binding protein hnRNP E1 enhances the invasiveness of epithelial-to-mesenchymal transitioned cells.
26047946 2015 Activin A inhibits BMP-signaling by binding ACVR2A and ACVR2B.
25833251 2014 Effects of activin A on survival, function and gene expression of pancreatic islets from non-diabetic and diabetic human donors.
25804741 2015 Activin A directs striatal projection neuron differentiation of human pluripotent stem cells.
25796148 2015 Expression of Cripto-1 gene protein and Activin-A in human lung adenocarcinoma tissue.
25751105 2015 Role of Activin A and myostatin in human cancer cachexia.
25729977 2015 Activin A is associated with asthma in underweight and overweight patients.
25659497 2015 ACVR2A promoter polymorphism rs1424954 in the Activin-A signaling pathway in trophoblasts.
25634576 2015 Exogenous supplementation of Activin A enhances germ cell differentiation of human embryonic stem cells.
25565002 2015 Longitudinal analysis of maternal serum Follistatin concentration in normal pregnancy and preeclampsia.
25557874 2015 Overexpression of activin-A and -B in malignant mesothelioma - attenuated Smad3 signaling responses and ERK activation promote cell migration and invasive growth.
25488476 2015 INHBA overexpression indicates poor prognosis in urothelial carcinoma of urinary bladder and upper tract.
25449777 2015 Activin signal promotes cancer progression and is involved in cachexia in a subset of pancreatic cancer.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25200295 2014 Brain amino acid sensing.
25114097 2014 Adipose stromal cells differentiate along a smooth muscle lineage pathway upon endothelial cell contact via induction of activin A.
25084052 2015 Activin A is anti-lymphangiogenic in a melanoma mouse model.
25062451 2014 Effects of recombinant activins on steroidogenesis in human granulosa-lutein cells.
24928494 2014 Effects of Activin A on the phenotypic properties of human periodontal ligament cells.
24916766 2014 Mesenchymal precursor cells maintain the differentiation and proliferation potentials of breast epithelial cells.
24778035 2014 Relation of INHBA gene expression to outcomes in gastric cancer after curative surgery.
24599287 2014 Serum inhibin A and inhibin B levels in epithelial ovarian cancer patients.
24571439 2014 Genome-wide association analyses of child genotype effects and parent-of-origin effects in specific language impairment.
24395917 2014 Activin A as a mediator of NK-dendritic cell functional interactions.
24378873 2014 Elevated expression of activins promotes muscle wasting and cachexia.
24336657 2014 Interferon-? suppresses activin A/NF-E2 induction of erythroid gene expression through the NF-?B/c-Jun pathway.
24302632 2014 Germline mutations of inhibins in early-onset ovarian epithelial tumors.
24227781 2013 Mast cells are dispensable for normal and activin-promoted wound healing and skin carcinogenesis.
24204752 2013 Follistatin is induced by ionizing radiation and potentially predictive of radiosensitivity in radiation-induced fibrosis patient derived fibroblasts.
24168163 2014 Downregulation of erythroid differentiation regulator 1 as a novel marker of skin tumors.
24139759 2013 PTP1B is an effector of activin signaling and regulates neural specification of embryonic stem cells.
24134550 2013 Activin A is associated with impaired myocardial glucose metabolism and left ventricular remodeling in patients with uncomplicated type 2 diabetes.
24107149 2014 Second trimester maternal serum inhibin-A in fetal anemia secondary to hemoglobin Bart's disease.
24085226 2013 Significance of INHBA expression in human colorectal cancer.
23831638 2013 Retinoic acid promotes Sertoli cell differentiation and antagonises activin-induced proliferation.
23812417 2013 Activin A impairs insulin action in cardiomyocytes via up-regulation of miR-143.
23808611 2013 Elevated Activin A urine levels are predictors of intraventricular haemorrhage in preterm newborns.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23781072 2013 Activin A suppresses osteoblast mineralization capacity by altering extracellular matrix (ECM) composition and impairing matrix vesicle (MV) production.
23589129 2013 1?,25-dihydroxyvitamin D3 stimulates activin A production to fine-tune osteoblast-induced mineralization.
23470693 2013 Genome-wide association studies of pit-and-fissure- and smooth-surface caries in permanent dentition.
23205865 2013 Maternal serum activin-A at 30-33 weeks in the prediction of preeclampsia.
23024260 2012 Activin A stimulates AKR1C3 expression and growth in human prostate cancer.
22845186 2012 Activin A and its regulatory molecules in placenta and fetal membranes of women with preterm premature rupture of the membranes associated with acute chorioamnionitis.
22685232 2012 High levels of activin A detected in preeclamptic placenta induce trophoblast cell apoptosis by promoting nodal signaling.
22579070 2012 Insensitivity to the growth inhibitory effects of activin A: an acquired capability in prostate cancer progression.
22549017 2012 Activin A induction of murine and ovine follicle-stimulating hormone ? transcription is SMAD-dependent and TAK1 (MAP3K7)/p38 MAPK-independent in gonadotrope-like cells.
22548442 2012 Activin A promotes hematopoietic fated mesoderm development through upregulation of brachyury in human embryonic stem cells.
22439617 2012 Umbilical activin A concentration as an early marker of perinatal hypoxia.
22425195 2012 Why does the fallopian tube fail in ectopic pregnancy? The role of activins, inducible nitric oxide synthase, and MUC1 in ectopic implantation.
22416010 2012 Diagnostic value of serum activin A and follistatin levels in women with peritoneal, ovarian and deep infiltrating endometriosis.
22296042 2012 Expression of inhibin/activin proteins and receptors in the human hypothalamus and basal forebrain.
22234949 2012 Activin A and cardiovascular disease in type 2 diabetes mellitus.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
22161160 2012 Activin-A overexpression in the murine lung causes pathology that simulates acute respiratory distress syndrome.
21992678 2012 Modulation of amniotic fluid activin-a and inhibin-a in women with preterm premature rupture of the membranes and infection-induced preterm birth.
21952245 2011 Mesenchymal activin-A overcomes defective human trisomy 21 trophoblast fusion.
21846490 2012 Concentration of activin A and follistatin in follicular fluid from human small antral follicles associated to gene expression of the corresponding granulosa cells.
21828274 2011 HEB and E2A function as SMAD/FOXH1 cofactors.
21767104 2011 Antenatal maternal antidepressants drugs affect Activin A concentrations in maternal blood, in amniotic fluid and in fetal cord blood.
21640344 2011 Activin-A is induced by interleukin-1? and tumor necrosis factor-? and enhances the mRNA expression of interleukin-6 and protease-activated receptor-2 and proliferation of stromal cells from endometrioma.
21576276 2011 Coding regions of INHBA, SFRP4 and HOXA10 are not implicated in familial endometriosis linked to chromosome 7p13-15.
21529351 2011 Inhibin secretion in women with the polycystic ovary syndrome before and after treatment with progesterone.
21475087 2010 Immunolabeling of the inhibin-?A and -?B subunit in normal and malignant human cervical tissue and cervical cancer cell lines.
21464440 2011 Activin A levels are associated with abnormal glucose regulation in patients with myocardial infarction: potential counteracting effects of activin A on inflammation.
21281489 2011 The nephrogenic potential of the transcription factors osr1, osr2, hnf1b, lhx1 and pax8 assessed in Xenopus animal caps.
21222045 2011 The relationship between fertility and lifespan in humans.
21132402 2012 Upregulated INHBA expression is associated with poor survival in gastric cancer.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20926007 Expression of activin A and follistatin in glioblastoma and their effects on U87 in vitro.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20720391 2010 Activin A in carcinoid heart disease: a possible role in diagnosis and pathogenesis.
20704626 2010 Value of serum and synovial fluid activin A and inhibin A in some rheumatic diseases.
20660033 2010 Growth differentiation factor 9 reverses activin A suppression of steroidogenic acute regulatory protein expression and progesterone production in human granulosa-lutein cells.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20634197 2010 Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20610541 2010 Genome-wide association study for colorectal cancer identifies risk polymorphisms in German familial cases and implicates MAPK signalling pathways in disease susceptibility.
20573232 2010 Tumor suppressor FLCN inhibits tumorigenesis of a FLCN-null renal cancer cell line and regulates expression of key molecules in TGF-beta signaling.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20309641 2010 Overexpression of activin A in oral squamous cell carcinoma: association with poor prognosis and tumor progression.
20226172 2010 Activin A induces neuronal differentiation and survival via ALK4 in a SMAD-independent manner in a subpopulation of human neuroblastomas.
20203128 2010 Activin promotes follicular integrity and oogenesis in cultured pre-antral bovine follicles.
20200332 2010 Family-based analysis of candidate genes for polycystic ovary syndrome.
20194748 2010 Activin A promotes multiple myeloma-induced osteolysis and is a promising target for myeloma bone disease.
20043075 2010 An 8-gene signature, including methylated and down-regulated glutathione peroxidase 3, of gastric cancer.
20036850 2010 Activin A in asphyxiated full-term newborns with hypoxic ischemic encephalopathy.
20028875 2010 DNA damage drives an activin a-dependent induction of cyclooxygenase-2 in premalignant cells and lesions.
19885849 2010 Identification of microRNAs regulated by activin A in human embryonic stem cells.
19736306 2010 Endoglin phosphorylation by ALK2 contributes to the regulation of prostate cancer cell migration.
19733294 2009 Activin and transforming growth factor-beta signaling pathways are activated after allergen challenge in mild asthma.
19661148 2009 Analysis of activin/TGFB-signaling modulators within the normal and dysfunctional adult human testis reveals evidence of altered signaling capacity in a subset of seminomas.
19641514 2010 Activin A as a marker of intrauterine infection in women with preterm prelabour rupture of membranes.
19615428 2009 Regulation of osteoblastogenesis and osteoclastogenesis by the other reproductive hormones, Activin and Inhibin.
19574343 2009 Quantitative trait loci predicting circulating sex steroid hormones in men from the NCI-Breast and Prostate Cancer Cohort Consortium (BPC3).
19539911 2009 Bone morphogenetic protein-6 stimulates gene expression of follicle-stimulating hormone receptor, inhibin/activin beta subunits, and anti-Müllerian hormone in human granulosa cells.
19386982 2009 Activin A, activin receptor type II, nodal, and cripto mRNA are expressed by eutopic and ectopic endometrium in women with ovarian endometriosis.
19383344 2008 TIMP-1 expression in human colorectal cancer is associated with TGF-B1, LOXL2, INHBA1, TNF-AIP6 and TIMP-2 transcript profiles.
19324968 2009 A novel role for the forkhead transcription factor FOXL2 in activin A-regulated follicle-stimulating hormone beta subunit transcription.
19308293 2009 Upregulated INHBA expression may promote cell proliferation and is associated with poor survival in lung adenocarcinoma.
19257827 2009 Activin A enhances prostate cancer cell migration through activation of androgen receptor and is overexpressed in metastatic prostate cancer.
19240652 2009 INHBA overexpression promotes cell proliferation and may be epigenetically regulated in esophageal adenocarcinoma.
19200970 2010 Evaluation of endometrial activin A secretion for prediction of pregnancy after intrauterine insemination.
19196915 2009 Elevated levels of activin A in clinical and experimental pulmonary hypertension.
19158274 2009 Key role for activin B in cellular transformation after loss of the von Hippel-Lindau tumor suppressor.
19141859 2009 Activin-A attenuates several human natural killer cell functions.
19128983 2009 Adiponectin upregulates monocytic activin A but systemic levels are not altered in obesity or type 2 diabetes.
19095948 2009 Activin C antagonizes activin A in vitro and overexpression leads to pathologies in vivo.
19091310 2009 Activin A down-regulates the phagocytosis of lipopolysaccharide-activated mouse peritoneal macrophages in vitro and in vivo.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19028479 2009 Relationship between activin A level and infarct size in patients with acute myocardial infarction undergoing successful primary coronary intervention.
19027859 2009 Synthesis, purification and bioactivity of recombinant human activin A expressed in the yeast Pichia pastoris.
18854336 2009 Adenoviral activin A expression prevents vein graft intimal hyperplasia in a rat model.
18768470 2008 The structure of FSTL3.activin A complex. Differential binding of N-terminal domains influences follistatin-type antagonist specificity.
18719101 2008 Highly efficient differentiation of hESCs to functional hepatic endoderm requires ActivinA and Wnt3a signaling.
18695873 2008 Activin A enhances MMP-7 activity via the transcription factor AP-1 in an esophageal squamous cell carcinoma cell line.
18608101 2008 Screening of hypoxia-inducible genes in sporadic ALS.
18600473 2009 Regulation of melanin synthesis by the TGF-beta family in B16 melanoma cells.
18535106 2008 Differential antagonism of activin, myostatin and growth and differentiation factor 11 by wild-type and mutant follistatin.
18460206 2008 The glycoprotein-hormones activin A and inhibin A interfere with dendritic cell maturation.
18450971 2008 The role of activin A and Akt/GSK signaling in ovarian tumor biology.
18423626 2008 High serum concentration of total inhibin in polycystic ovary syndrome.
18413775 2008 Genetic variation in the inhibin pathway and risk of testicular germ cell tumors.
18381582 2008 Concentration of anti-Müllerian hormone and inhibin-B in relation to steroids and age in follicular fluid from small antral human follicles.
18359784 2008 Activin A increases invasiveness of endometrial cells in an in vitro model of human peritoneum.
18353928 2008 A dual role of activin A in regulating immunoglobulin production of B cells.
18319260 2008 GLI2-specific transcriptional activation of the bone morphogenetic protein/activin antagonist follistatin in human epidermal cells.
18299275 2008 Production and function of activin A in human dendritic cells.
18166170 2008 Activin signals via SMAD2/3 between germ and somatic cells in the human fetal ovary and regulates kit ligand expression.
18156495 2008 Activin-A: a novel dendritic cell-derived cytokine that potently attenuates CD40 ligand-specific cytokine and chemokine production.
18089557 2008 Cripto is a noncompetitive activin antagonist that forms analogous signaling complexes with activin and nodal.
18077449 2008 Hypoxia promotes the differentiated human articular chondrocyte phenotype through SOX9-dependent and -independent pathways.
18001154 Activin subunit and receptor expression in normal and cleft human fetal palate tissues.
17968943 2007 Activin A is an anticatabolic autocrine cytokine in articular cartilage whose production is controlled by fibroblast growth factor 2 and NF-kappaB.
17954979 2007 Effect of the human follicle-stimulating hormone-binding inhibitor and its N-terminal fragment on follicle-stimulating hormone-induced progesterone secretion by granulosa cells in vitro.
17929017 2008 Basic fibroblast growth factor inhibits p38-mediated cell differentiation and growth inhibition by activin A but not by histone deacetylase inhibitors in CML cells.
17909904 2008 Activin a causes cancer cell aggressiveness in esophageal squamous cell carcinoma cells.
17681301 2008 Human granulosa-lutein cell in vitro production of progesterone, inhibin A, inhibin B, and activin A are dependent on follicular size and not the presence of the oocyte.
17478557 2007 In vitro evidence suggests activin-A may promote tissue remodeling associated with human luteolysis.
17462637 2007 Serum anti-Müllerian hormone and inhibin B in disorders of spermatogenesis.
17436000 2007 Activin A suppresses interleukin-1-induced matrix metalloproteinase 3 secretion in human chondrosarcoma cells.
17384470 2007 Activin A as a critical mediator of capillary formation: interaction with the fibroblast growth factor action.
17204604 2007 Activin a efficiently specifies definitive endoderm from human embryonic stem cells only when phosphatidylinositol 3-kinase signaling is suppressed.
16988001 2007 Activin A decreases glucagon and arx gene expression in alpha-cell lines.
16820918 2006 The autocrine effect of activin A on human ovarian clear cell adenocarcinoma cells.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16643884 2006 Activin A is an endogenous inhibitor of ureteric bud outgrowth from the Wolffian duct.
16482217 2006 Structural basis for the inhibition of activin signalling by follistatin.
16423381 2006 Inhibin/activin subunits beta-A (-betaA) and beta-B (-betaB) are differentially localised in normal, hyperplastic and malignant human endometrial tissue.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16198295 2005 The structure of the follistatin:activin complex reveals antagonism of both type I and type II receptor binding.
16081641 2005 Transforming growth factor beta-activated kinase 1 is a key mediator of ovine follicle-stimulating hormone beta-subunit expression.
15950648 2005 Inhibin A and activin A may be used to predict pregnancy outcome in women with recurrent miscarriage.
15737465 2005 Activin A inhibits differentiation of 3T3-L1 preadipocyte.
15580313 2005 High activin A-expression in human neuroblastoma: suppression of malignant potential and correlation with favourable clinical outcome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15451575 2004 FLRG, member of the follistatin family, a new player in hematopoiesis.
15451571 2004 Activin, inhibin and the human breast.
15374731 2004 Serum inhibin A, inhibin B, pro-alphaC, and activin A levels in women with idiopathic premature ovarian failure.
15292256 2004 Proteomic analysis of articular cartilage shows increased type II collagen synthesis in osteoarthritis and expression of inhibin betaA (activin A), a regulatory molecule for chondrocytes.
15205401 2004 Mutational analysis of the mature peptide region of inhibin genes in Indian women with ovarian failure.
15188178 2004 Activin A stimulates vascular endothelial growth factor gene transcription in human hepatocellular carcinoma cells.
15123686 2004 An activin mutant with disrupted ALK4 binding blocks signaling via type II receptors.
15123352 2004 Activin A augments vascular endothelial growth factor activity in promoting branching tubulogenesis in hepatic sinusoidal endothelial cells.
15094188 2004 hCHL2, a novel chordin-related gene, displays differential expression and complex alternative splicing in human tissues and during myoblast and osteoblast maturation.
15070957 2004 Inhibin B and anti-Müllerian hormone, but not testosterone levels, are normal in infants with nonmosaic Klinefelter syndrome.
15031321 2004 Activin inhibits pituitary prolactin expression and cell growth through Smads, Pit-1 and menin.
14993131 2004 Elevated levels of activin A in heart failure: potential role in myocardial remodeling.
14738881 2004 Expression of activin subunits and receptors in the developing human ovary: activin A promotes germ cell survival and proliferation before primordial follicle formation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14671321 2003 Homeoprotein DLX-1 interacts with Smad4 and blocks a signaling pathway from activin A in hematopoietic cells.
14671202 2003 Endothelial cells and peripheral blood mononuclear cells are a potential source of extraplacental activin a in preeclampsia.
14613548 2003 Activin promotes oocyte development in ovine preantral follicles in vitro.
12877256 2003 Serum inhibin B correlates with successful ovulation in infertile women.
12853948 2003 The DNA sequence of human chromosome 7.
12721183 2003 Characterization of plasma inhibin forms in fertile and infertile men.
12702211 2003 Activin-A up-regulates type I activin receptor mRNA levels in human immortalized extravillous trophoblast cells.
12697670 2003 Differential binding and neutralization of activins A and B by follistatin and follistatin like-3 (FSTL-3/FSRP/FLRG).
12690205 2003 Human chromosome 7: DNA sequence and biology.
12665510 2003 Activin a signaling induces Smad2, but not Smad3, requiring protein kinase a activity in granulosa cells from the avian ovary.
12660162 2003 Structures of an ActRIIB:activin A complex reveal a novel binding mode for TGF-beta ligand:receptor interactions.
12651901 2003 Inhibin, activin, follistatin, activin receptors and beta-glycan gene expression in the placental tissue of patients with pre-eclampsia.
12587530 2002 Pre-eclampsia with fetal growth restriction: placental and serum activin A and inhibin A levels.
12524226 2003 Cardiac ankyrin repeat protein (CARP) expression in human and murine atherosclerotic lesions: activin induces CARP in smooth muscle cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12456957 2002 The role of activin a in regulation of hemopoiesis.
12414903 2002 Production of activins by the human endosalpinx.
12399529 Possible relationship between seminal plasma inhibin B and spermatogenesis in patients with azoospermia.
12324653 2002 Activins, inhibins, and follistatins: from endocrinology to signaling. A paradigm for the new millennium.
12213882 2002 Expression of activin/inhibin receptor and binding protein genes and regulation of activin/inhibin peptide secretion in human adrenocortical cells.
12161551 2002 Activin A promotes human endometrial stromal cell decidualization in vitro.
12149426 2002 Potent induction of activin A secretion from monocytes and bone marrow stromal fibroblasts by cognate interaction with activated T cells.
12088879 2002 Regulation of endometrial adenocarcinoma cell proliferation by Activin-A and its modulation by 17beta-estradiol.
11969340 2002 The distribution of activin and activin receptors in gestational tissues across human pregnancy and during labour.
11948405 2002 Transcription activation of FLRG and follistatin by activin A, through Smad proteins, participates in a negative feedback loop to modulate activin A function.
11459787 2001 Human follistatin-related protein: a structural homologue of follistatin with nuclear localization.
11344232 2001 Inhibin/activin betaB-subunit expression in pheochromocytomas favors benign diagnosis.
11266516 2001 Modulation of activin signal transduction by inhibin B and inhibin-binding protein (INhBP).
11134153 2000 Localization of activin beta(A)-, beta(B)-, and beta(C)-subunits in humanprostate and evidence for formation of new activin heterodimers of beta(C)-subunit.
10932194 2000 Insertion of Inhbb into the Inhba locus rescues the Inhba-null phenotype and reveals new activin functions.
10865214 2000 Activin increases bone mass and mechanical strength of lumbar vertebrae in aged ovariectomized rats.
10859029 2000 A secreted tumor-suppressor, mac25, with activin-binding activity.
10746731 2000 Betaglycan binds inhibin and can mediate functional antagonism of activin signalling.
10320815 1999 A novel role of activin in inflammation and repair.
9884026 1998 The role of activin type I receptors in activin A-induced growth arrest and apoptosis in mouse B-cell hybridoma cells.
9872992 1999 Endoglin is an accessory protein that interacts with the signaling receptor complex of multiple members of the transforming growth factor-beta superfamily.
9202237 1997 Inhibin interferes with activin signaling at the level of the activin receptor complex in Chinese hamster ovary cells.
9166111 1997 Development, validation and application of a two-site enzyme-linked immunosorbent assay for activin-AB.
9032295 1997 Activin and inhibin have antagonistic effects on ligand-dependent heteromerization of the type I and type II activin receptors and human erythroid differentiation.
8955111 1996 Human activin betaA gene. Identification of novel 5' exon, functional promoter, and enhancers.
8397373 1993 Activin receptor-like kinases: a novel subclass of cell-surface receptors with predicted serine/threonine kinase activity.
8267637 1993 Activin A induces apoptotic cell death.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7890768 1995 Inhibin antagonizes inhibition of liver cell growth by activin by a dominant-negative mechanism.
7887917 1995 The heparin binding site of follistatin is involved in its interaction with activin.
3758355 1986 Human inhibin genes. Genomic characterisation and sequencing.
3754442 1986 Structure of two human ovarian inhibins.
3345731 1988 Inhibin: definition and nomenclature, including related substances.
3267209 1988 Erythroid differentiation factor is encoded by the same mRNA as that of the inhibin beta A chain.
2767687 1989 Mapping of genes for inhibin subunits alpha, beta A, and beta B on human and mouse chromosomes and studies of jsd mice.
2575216 1989 Activin B: precursor sequences, genomic structure and in vitro activities.
1777673 1991 Structure and sequence analysis of the human activin beta A subunit gene.
1646080 1991 Expression cloning of an activin receptor, a predicted transmembrane serine kinase.
1310063 1992 Effect of activin A on globin gene expression in purified human erythroid progenitors.