Property Summary

NCBI Gene PubMed Count 144
PubMed Score 276.39
PubTator Score 322.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pituitary cancer 1.700 1.4e-05

Protein-protein Interaction (8)

Gene RIF (119)

PMID Text
26654447 the correlation between placental DNAm of INHBA/FN1 and maternal serum INHA/FN1 levels indicate that DNAm may be a useful tool to identify novel biomarkers for adverse pregnancy outcomes in some cases.
26452703 The Sertoli cell hormones inhibin-B and anti Mullerian hormone have different patterns of secretion in prepubertal cryptorchid boys.
25617520 For INHA gene c.-124G>A, males carrying c.-124GG genotype and c.-124GA genotype showed an increased risk of non-normozoospermic syndrome.
25445105 The present study did not find an association between INHA-124A>G and -16C>T and the risk of premature ovarian failure (POF). For the 769G>A mutation, Asian women with the 769A allele were found to be susceptible to POF.
25358080 Inhibin alpha gene expression in human trophoblasts is regulated by interactions between TFAP2 and cAMP signaling pathways.
25329118 Inhibin alpha-subunit, Melan A and MNF116 were not sensitive for pheochromocytomas.
25111790 Aberrant methylation and common genetic variation in the INHA promoter occur in human adrenocortical carcinoma and are associated with decreased INHA expression.
24599287 Serum inhibin levels correlate with clinical characteristics and mortality in epithelial ovarian cancer patients.
24269065 When two variant alleles of inhibin alpha gene promoter are combined, the c.-16C>T and c.-124A>G polymorphisms are associated with increased primary ovarian insufficiency risk in Korean women.
24107149 Maternal serum inhibin-A levels were significantly higher in pregnancies with fetal Hb Bart's disease.
24012099 Data indicate that fallopian tube and the epithelial component of Brenner tumours (BTs) expressed AKR1C3 and androgen receptor, but the tumour stromal cells showed strong expression of calretinin, inhibin and steroidogenic factor 1 in the majority of BTs.
23836275 Serum inhibin B was significantly higher in breastfed adolescent males than in their peers.
23756051 Data suggest placentation (here, placenta basal plate surface area) and maternal serum PAPP-A (pregnancy-associated plasma protein A) are significantly lower and maternal serum INHA is significantly higher in pre-eclampsia than in control subjects.
23724521 located in the syncytiotrophoblast and the intermediate trophoblast of the placenta during early pregnancy; no remarkable findings in placentas of pathological gestations
22585605 A subset of primary mixed or acinar and mucin-producing acinar carcinomas (10%) and large-cell carcinomas (22%) expressed inhibin-alpha.
22581369 the inhibinalpha gene is transcriptionally silenced in human gastric cancer cells
22430733 Expression of transcription factors controlling alpha inhibin gene expression in placental tissues from pregnancies affected by fetal Down syndrome.
22417854 inhibin alpha had a diagnostic role, differentiating between the adrenocortical and adrenomedullary neoplasms. Inhibin/activin beta might play a predictive role for malignant potential in pheochromocytoma.
22296042 Inhibin alpha subunit staining is not detected in any of the major anatomical regions of the human brain.
22267736 Inhibin alpha-subunit N terminus interacts with activin type IB receptor to disrupt activin signaling.
22127493 Inhibin pro-alphaC is produced by the adrenal gland. Differentiation between adrenocortical adenoma (ADA) and adrenocortical carcinoma (ACC) by serum inhibin pro-alphaC is limited, but its levels may constitute a novel tumor marker for ACC.
22055401 This is the first report of immunoreactivity for inhibin-alpha and synaptophysin in synovial sarcoma
21992678 Human amniotic fluid activin-A and inhibin-A are involved in biological processes linked to intra-amniotic infection/inflammation-induced preterm birth.
21809377 Inhibin A enhances bone formation during distraction osteogenesis.
21785376 The inhibin-alpha -16C/T and -124A/G polymorphisms are genetic factors associated with the prevalence of premature ovarian failure in Korean women.
21708117 GRP94, FN14, and inhibin have roles in brain and non-brain metastases in ErbB-2+ and ErbB-2- breast neoplasms
21707703 Inhibin bodies are a new marker for immature Sertoli cells.
21535305 Serum inhibin A level might be a useful biomarker for diagnosis and monitoring of preeclampsia
21529351 Data show that inhibin A levels were significantly lower in the PCOS group compared to the control group, and inhibin B levels were comparable in the two groups.
21388678 Our data support the hypothesis that elevated second trimester maternal serum levels of total hCG and/or inhibin-A may result from premature accelerated differentiation of the villous cytotrophoblasts.
21263247 The PAX2(-), PAX8(-), and inhibin A(+) profile supports the diagnosis of hemangioblastoma with a sensitivity of 95%, specificity of 100%, and positive predictive value of 100%.
21252475 study showed that inhibin A was an important predictable marker of preeclampsia
21174065 Inhibin-alpha subunit expression in uterine endometrioid adenocarcinomas and endometrial cancer cell lines: a potential prognostic factor.
21115906 Increase in Inhibin A is associated with breast cancer.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20716560 Observational study of gene-disease association. (HuGE Navigator)
20704626 Report serum/synovial fluid activin A and inhibin A levels in rheumatoid arthritis, systemic lupus erythematosus and knee ostoearthritis.
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20209104 analysis of the evolutionary origin of the inhibin alpha-subunit, a unique TGFbeta superfamily antagonist
20188029 The data suggest that, in humans, inhibin is secreted by Sertoli cells into the seminiferous tubules and then travels towards the efferent ducts, where it is reabsorbed into the bloodstream.
19752047 Meta-analysis of gene-disease association. (HuGE Navigator)
19615428 The gonadally derived Inhibins are important regulators of locally produced osteotrophic factors.
19589860 Inhibin B is a more potent suppressor of rat FSH release in vitro and in vivo than inhibin A.
19574343 Observational study of gene-disease association. (HuGE Navigator)
19542176 Data show no evidence of association between the polymorphisms of the inhibin alpha gene (G769A, C16T and A124G) and premature ovarian failure.
19542176 Meta-analysis of gene-disease association. (HuGE Navigator)
19436293 INH alpha expression in the primary prostate tumour can be used as a predictive factor for prognosis of prostate cancer
19412349 Activin A and inhibin A levels declined rapidly with placental delivery in NP and pre-eclamptic pregnancies.
19391217 Calponin and alpha-inhibin are the most useful positive markers for serous microcystic adenoma, and are negative in most entities in the differential diagnosis.
19363042 association between INHA promoter variants & premature ovarian failure could not be replicated. Results suggest that this discrepancy is likely to be due to small sample size of previous studies.
19363042 Observational study of gene-disease association. (HuGE Navigator)
19324345 in the inhibin alpha gene is strongly associated with premature ovarian failure in Indian patients.
19324345 Observational study of gene-disease association. (HuGE Navigator)
19195690 Immunohistochemistry detected inhibin-alpha, -betaA and -betaB, Ki67, p53 and glycodelin A in invasive trophoblastic mole.
19107499 Inhibin A levels were greater in the severe than in the mild preeclampsia group
19079962 ectopic pregnancy yielded significantly lower inhibin A concentrations compared with normal pregnancy & similar concentrations to non-pregnant controls; Inhibin A concentrations in abnormal pregnancies were significantly lower than in normal pregnancy
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19003635 Levels of inhibin A in the preeclampsia group were greater than in the normotensive group.
18852530 The 769G>A variant of the INHalpha gene may be rare in Korean patients with preeclampsia.
18852530 Observational study of gene-disease association. (HuGE Navigator)
18826955 Activin stimulates endogenous inhibin alpha- and betaB-subunit mRNA, protein, and proteolytic processing. Simultaneously, activin stimulated the proconvertase furin through a Smad2/3-dependent process.
18630123 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18460206 InA interferes with selected aspects of DC maturation & may help prevent activation of allogenic T-cells by the embryo. This may promote the generation of tolerance-inducing DCs.
18423626 Women with polycystic ovary syndrome have high serum concentration of total inhibin but not of inhibin A or inhibin B.
18413775 Observational study of gene-disease association. (HuGE Navigator)
18397882 a high affinity interaction between betaglycan and residues Val(108)-Tyr(120) of the inhibin alpha-subunit mediate inhibin A biological activity
18249384 INHA promoter variants are associated with the development of premature ovarian failure.
18249384 Observational study of gene-disease association. (HuGE Navigator)
18091323 the combinational characterization of calretinin (either by polyclonal or monoclonal antibody), inhibin alpha, and Melan-A expression is of great significance in the differential diagnosis of adrenocortical tumors.
18047273 analysis of human follicular fluid samples of patients undergoing controlled ovarian hyper stimulation for in vitro fertilization therapy identified SHBG and INHA
17933751 INHA 769G>A variant may increase susceptibility to premature ovarian failure with impaired inhibin B bioactivity
17603052 Inhibin A increases strongly in the late follicular phase.
17457606 The expression of estrogen receptors, progesterone receptors, and inhibin-alpha in the ovarian-like stroma supports the likely hormonal dependence of this tumor and probably explains its almost exclusive occurrence in women.
17272393 glycosylation of Asn(302) of the alpha-subunit of inhibin A and B results in a decrease in bioactivity, and the effect on inhibin A, at least, is explained by its reduced affinity to betaglycan
17074342 The lower expression of follistatin and beta A subunit in women with recurrent miscarriage may imply an altered activity of activin A at the time of decidualization, which may lead to poor pregnancy outcome in the form of miscarriage.
16989826 The present findings showed that treatment with vaginal estroprogestinic decreases serum inhibin A and inhibin B levels, the follicular diameter.
16778388 inhibin A may have a role in development of severe preeclampsia
16758344 dimeric inhibins do not play a central role in the endocrinological imbalance observed in polycystic ovary syndrome
16723387 polymorphisms in the INHA gene may have a role in ovarian failure
16670820 A significant lower expression of the inhibin-alpha subunit in IUGR extravillous trophoblast compared to normal pregnancies was observed.
16650414 Higher levels of inhibin A and B are associated with oocyte presence but not with fertilization rates.
16621788 analysis of inhibin and transforming growth factor beta-binding sites on betaglycan
16423381 A strong colocalisation of inhibin-alpha and -betaA could be demonstrated in malignant endometrial tissue.
16396934 Observational study of gene-disease association. (HuGE Navigator)
16396934 16C>T and 769G>A variants in INHalpha gene may not be associated to premature ovarian failure disease.
16390856 Observational study of gene-disease association. (HuGE Navigator)
16390856 Inheritance of specific INHA promoter haplotypes predispose to the development of premature ovarian failure.
16195413 Discordant pattern of inhibin A and inhibin B during the rat estrous cycle is due to independent populations of antral follicles making inhibin B (small antral follicles) or inhibin A (large antral follicles).
16161415 Observational study of genotype prevalence. (HuGE Navigator)
16048795 conclude that obese women present less percentage variation of both inhibin A and B during the menstrual cycle, associated with a low frequency of ovulatory cycles
15950648 Inhibin A and activin A may be used as markers to predict pregnancies that are likely to miscarry.
15816368 Observational study of gene-disease association. (HuGE Navigator)
15745937 The lower inhibin alpha and betaglycan expression in endometrial adenocarcinoma suggests that the inhibin action may be disrupted.
15578072 Inhibin A expressed in primary clear cell renal cell carcinoma (2/16, 13%) and metastatic clear cell renal cell carcinoma (3/5, 60%).
15562017 Ovulatory cycles were characterized by higher FSH and lower inhibin A leveels in hypergonadotropic hypogonadism or premature ovarian failure.
15551748 Expressed in Sertoli cells in oligozoospermia.
15451570 review article supports the hypothesis that tumor suppressor activities of the inhibin alpha subunit dominate in non-malignant tissue, but its oncogenic activities emerge during tumorigenesis
15374731 Women with premature ovarian failure showed low levels of inhibin A
15236099 Activin A and inhibin A appear to be viable candidates as laboratory parameters for detection of pregnancy induced hypertension.
15227735 Observational study of gene-disease association. (HuGE Navigator)
15227735 no variation between the normal subjects and the premature ovarian failure patients; G769A variation of INHalpha is rare in Korea women with POF.
15214825 study expands the immunophenotype of granular cell tumor (S100, CD68, protein gene product 9.5, and inhibin-alpha) regardless of location and supports a neural origin
15205401 The INHalpha gene is a strong candidate gene for ovarian failure
14967395 Serum inhibin A may be helpful in predicting the failure of pregnancies.
14667886 role as a marker for pregnancy viability
14596968 Molecular analysis of the katG codon 315 and the promoter region of the inhA is a good alternative to diagnose isoniazid resistance in South Kore.a
12857425 significant correlation between arterial and venous levels of inhibin A, inhibin B and activin A was found in umbilical cord artery and vein; findings suggest the placenta is the main source of inhibin B and the fetus of activin A in the umbilical cord
12721183 Proportions of precursor inhibin B and alpha-subunit forms in the circulation are unchanged in men with spermatogenic disorders indicating there is no alteration of the Sertoli cell inhibin secretory pattern.
12682233 Mast cell-derived activin A may play an important role in airway remodeling in patients with asthma at least in part by mediating the proliferation of airway smooth muscle cells.
12679471 estradiol exerts a greater role over inhibin in FSH-negative feedback regulation during the luteal phase while inhibin A and/or B plays a more critical role as the follicular phase progresses
12660265 results suggest dissociation between major sources of inhibin A and inhibin pro-alpha C in early pregnancy; identified a link between production of pro-alpha C and luteal steroidogenesis and a predominantly feto-placental origin of inhibin A
12651901 Results quantify the relative expression of inhibin alpha, inhibin/activin beta(A), beta(B), beta(C), follistatin, activin receptors and beta-glycan genes in placental tissue of term pre-eclamptic patients.
12587530 data suggest that the increased placental expression of inhibin subunit mRNAs is part of the mechanism leading to increased serum activin A and inhibin A levels
12576745 Preliminary results show that inhibin A levels are raised in Asian women affected with fetal Down syndrome and sex chromosome abnormality.
12493718 To determine which cell types in the testes may produce inhibin B, the localization of the two subunits of inhibin B was examined in adult testicular biopsies with normal spermatogenesis, spermatogenic arrest, or Sertoli cell only tubules.
12456605 findings suggest that inhibin A is a specific marker of early pregnancy loss before the onset of the clinical symptoms of recurrent miscarriage
12093833 Observational study of gene-disease association. (HuGE Navigator)
12093833 Patients affected by premature ovarian failure for the missense mutation (769G-->A transition) in the exon 2 of the INHalpha gene.
11818495 DNA hypermethylation of the inhibin alpha-subunit gene in prostate carcinoma

AA Sequence

MVLHLLLFLLLTPQGGHSCQGLELARELVLAKVRALFLDALGPPAVTREGGDPGVRRLPRRHALGGFTHR      1 - 70
GSEPEEEEDVSQAILFPATDASCEDKSAARGLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQ     71 - 140
GTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLHLATSALSLLTHPVLVLLLRCPLCTCSARPE    141 - 210
ATPFLVAHTRTRPPSGGERARRSTPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWI    211 - 280
VYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSF    281 - 350
KYETVPNLLTQHCACI                                                          351 - 366
//

Text Mined References (146)

PMID Year Title
26654447 2015 Placental DNA methylation at term reflects maternal serum levels of INHA and FN1, but not PAPPA, early in pregnancy.
26452703 2016 The Sertoli cell hormones inhibin-B and anti Müllerian hormone have different patterns of secretion in prepubertal cryptorchid boys.
25617520 2015 Polymorphisms in inhibin ? gene promoter associated with male infertility.
25445105 2014 Gene variation and premature ovarian failure: a meta-analysis.
25416956 2014 A proteome-scale map of the human interactome network.
25358080 2014 Inhibin alpha gene expression in human trophoblasts is regulated by interactions between TFAP2 and cAMP signaling pathways.
25329118 2014 Inhibin alpha-subunit, Melan A and MNF116 in pheochromocytomas.
25111790 2014 Inhibin alpha-subunit (INHA) expression in adrenocortical cancer is linked to genetic and epigenetic INHA promoter variation.
25051334 2014 Inhibin at 90: from discovery to clinical application, a historical review.
24599287 2014 Serum inhibin A and inhibin B levels in epithelial ovarian cancer patients.
24302632 2014 Germline mutations of inhibins in early-onset ovarian epithelial tumors.
24269065 2014 Association of inhibin ? gene promoter polymorphisms with risk of idiopathic primary ovarian insufficiency in Korean women.
24107149 2014 Second trimester maternal serum inhibin-A in fetal anemia secondary to hemoglobin Bart's disease.
24012099 2013 Ovarian Brenner tumour: a morphologic and immunohistochemical analysis suggesting an origin from fallopian tube epithelium.
23836275 2013 Association of breastfeeding with higher serum inhibin B level at adolescence.
23756051 2013 2D-Ultrasound and endocrinologic evaluation of placentation in early pregnancy and its relationship to fetal birthweight in normal pregnancies and pre-eclampsia.
23724521 2013 Immunohistochemical study of inhibin A and B expression in placentas from normal and pathological gestations.
22585605 2012 Immunohistochemical evaluation of inhibin-alpha in non-small-cell lung carcinomas--a pitfall in diagnosing metastatic pulmonary carcinomas.
22581369 2012 Transcriptional silencing of the inhibin-? gene in human gastric carcinoma cells.
22430733 2012 Expression of transcription factors controlling alpha inhibin gene expression in placental tissues from pregnancies affected by fetal Down syndrome.
22417854 2012 Diagnostic role of inhibin ?-subunit and inhibin/activin ?-subunit in adrenal cortical and medullary tumors in Egyptian patients.
22296042 2012 Expression of inhibin/activin proteins and receptors in the human hypothalamus and basal forebrain.
22267736 2012 Inhibin ?-subunit N terminus interacts with activin type IB receptor to disrupt activin signaling.
22127493 2012 Serum inhibin pro-?C is a tumor marker for adrenocortical carcinomas.
22055401 2012 Inhibin-? and synaptophysin immunoreactivity in synovial sarcoma with granular cell features.
21992678 2012 Modulation of amniotic fluid activin-a and inhibin-a in women with preterm premature rupture of the membranes and infection-induced preterm birth.
21809377 2012 Inhibin A enhances bone formation during distraction osteogenesis.
21785376 2011 Relationship between inhibin-? gene polymorphisms and premature ovarian failure in Korean women.
21708117 2011 Expression of endoplasmic reticulum stress proteins is a candidate marker of brain metastasis in both ErbB-2+ and ErbB-2- primary breast tumors.
21707703 2011 Inhibin bodies: a new marker for immature Sertoli cells.
21535305 2011 Placental and maternal serum inhibin A in patients with preeclampsia and small-for-gestational-age.
21529351 2011 Inhibin secretion in women with the polycystic ovary syndrome before and after treatment with progesterone.
21388678 2011 Villous trophoblast abnormalities in extremely preterm deliveries with elevated second trimester maternal serum hCG or inhibin-A.
21263247 2011 PAX2(-)/PAX8(-)/inhibin A(+) immunoprofile in hemangioblastoma: A helpful combination in the differential diagnosis with metastatic clear cell renal cell carcinoma to the central nervous system.
21252475 2011 Early detection of preeclampsia using inhibin a and other second-trimester serum markers.
21174065 2011 Inhibin-? subunit expression in uterine endometrioid adenocarcinomas and endometrial cancer cell lines: a potential prognostic factor.
21115906 2010 Inhibin A is down-regulated during chemotherapy in patients with breast cancer.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20716560 2010 Genetic variation within the hypothalamus-pituitary-ovarian axis in women with recurrent miscarriage.
20704626 2010 Value of serum and synovial fluid activin A and inhibin A in some rheumatic diseases.
20634197 2010 Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium.
20209104 2010 Phylogenomic analyses reveal the evolutionary origin of the inhibin alpha-subunit, a unique TGFbeta superfamily antagonist.
20188029 2010 Immunodetection of inhibin in the human testis and epididymis during normal development and in non-tumoural testicular lesions.
19752047 Inhibin and premature ovarian failure.
19615428 2009 Regulation of osteoblastogenesis and osteoclastogenesis by the other reproductive hormones, Activin and Inhibin.
19589860 2009 Inhibin B is a more potent suppressor of rat follicle-stimulating hormone release than inhibin a in vitro and in vivo.
19574343 2009 Quantitative trait loci predicting circulating sex steroid hormones in men from the NCI-Breast and Prostate Cancer Cohort Consortium (BPC3).
19542176 2009 Inhibin alpha gene and susceptibility to premature ovarian failure: a data synthesis.
19436293 2009 Elevated level of inhibin-alpha subunit is pro-tumourigenic and pro-metastatic and associated with extracapsular spread in advanced prostate cancer.
19412349 2009 Maternal circulating levels of activin A, inhibin A, sFlt-1 and endoglin at parturition in normal pregnancy and pre-eclampsia.
19391217 2009 Calponin is expressed in serous cystadenomas of the pancreas but not in adenocarcinomas or endocrine tumors.
19363042 2009 A large-scale association study to assess the impact of known variants of the human INHA gene on premature ovarian failure.
19324345 2010 Mutational analysis of inhibin alpha gene revealed three novel variations in Indian women with premature ovarian failure.
19195690 2009 Invasive hydatidiform mole: immunohistochemical labelling of inhibin/activin subunits, Ki67, p53 and glycodelin A in a rare case.
19107499 2009 Inhibin A levels and severity of preeclampsia.
19079962 2008 Inhibin A: marker for diagnosis of ectopic and early abnormal pregnancies.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19003635 2008 Serum inhibin A level in preeclampsia and normotensive pregnancy.
18852530 2008 The 769G>A variant of the inhibin-alpha gene in Korean patients with preeclampsia.
18826955 2008 An activin/furin regulatory loop modulates the processing and secretion of inhibin alpha- and betaB-subunit dimers in pituitary gonadotrope cells.
18630123 [Molecular-genetic analysis of natural and stimulated ovulation impairment].
18460206 2008 The glycoprotein-hormones activin A and inhibin A interfere with dendritic cell maturation.
18423626 2008 High serum concentration of total inhibin in polycystic ovary syndrome.
18413775 2008 Genetic variation in the inhibin pathway and risk of testicular germ cell tumors.
18397882 2008 Suppression of inhibin A biological activity by alterations in the binding site for betaglycan.
18249384 2009 Investigating the association between inhibin alpha gene promoter polymorphisms and premature ovarian failure.
18091323 2008 Comparison of immunohistochemical markers in the differential diagnosis of adrenocortical tumors: immunohistochemical analysis of adrenocortical tumors.
18047273 2008 Proteomic analysis of human follicular fluid using an alternative bottom-up approach.
17933751 2007 Functional analysis of the human inhibin alpha subunit variant A257T and its potential role in premature ovarian failure.
17847007 2007 Mutation in WNT10A is associated with an autosomal recessive ectodermal dysplasia: the odonto-onycho-dermal dysplasia.
17603052 2008 Statistically significant changes of antimüllerian hormone and inhibin levels during the physiologic menstrual cycle in reproductive age women.
17457606 2007 Expression of estrogen and progesterone receptors and inhibin-alpha in hepatobiliary cystadenoma: an immunohistochemical study.
17272393 2007 Inhibin A and B in vitro bioactivities are modified by their degree of glycosylation and their affinities to betaglycan.
17074342 2006 A study of luteal phase expression of inhibin, activin, and follistatin subunits in the endometrium of women with recurrent miscarriage.
16989826 2006 Vaginally administered estroprogestinic decreases serum inhibin A and inhibin B levels and reduces endometrial thickness.
16778388 2006 Maternal serum and amniotic fluid inhibin A levels in women who subsequently develop severe preeclampsia.
16758344 2006 Luteal-phase inhibin A and follicular-phase inhibin B levels are not characteristic of patients with an elevated LH-to-FSH ratio.
16723387 2006 Expansion of the germline analysis for the INHA gene in Indian women with ovarian failure.
16670820 2006 Expression of inhibin/activin subunits alpha (-alpha), beta A (-beta (A)) and beta B (-beta (B)) in placental tissue of normal and intrauterine growth restricted (IUGR) pregnancies.
16650414 2006 Follicular fluid levels of inhibin A, inhibin B, and activin A levels reflect changes in follicle size but are not independent markers of the oocyte's ability to fertilize.
16621788 2006 Identification of distinct inhibin and transforming growth factor beta-binding sites on betaglycan: functional separation of betaglycan co-receptor actions.
16423381 2006 Inhibin/activin subunits beta-A (-betaA) and beta-B (-betaB) are differentially localised in normal, hyperplastic and malignant human endometrial tissue.
16396934 2006 Controversial role of inhibin alpha-subunit gene in the aetiology of premature ovarian failure.
16390856 2005 INHA promoter polymorphisms are associated with premature ovarian failure.
16195413 2006 Follicle size class contributes to distinct secretion patterns of inhibin isoforms during the rat estrous cycle.
16161415 [The use of DNA analysis for diagnostics of hereditary premature ovarian failure].
16048795 2005 Abnormal inhibin A and inhibin B secretion in obese women with and without insulin resistance.
15950648 2005 Inhibin A and activin A may be used to predict pregnancy outcome in women with recurrent miscarriage.
15816368 2005 Mutational analysis of the inhibin alpha gene in preeclamptic women.
15745937 2005 Inhibin alpha-subunit and the inhibin coreceptor betaglycan are downregulated in endometrial carcinoma.
15578072 2005 Immunoreactivity of CD10 and inhibin alpha in differentiating hemangioblastoma of central nervous system from metastatic clear cell renal cell carcinoma.
15562017 2005 Relationship of estradiol and inhibin to the follicle-stimulating hormone variability in hypergonadotropic hypogonadism or premature ovarian failure.
15551748 Differential regulation of inhibin subunits by germ cells in human testes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15451570 2004 Re-evaluation of inhibin alpha subunit as a tumour suppressor in prostate cancer.
15374731 2004 Serum inhibin A, inhibin B, pro-alphaC, and activin A levels in women with idiopathic premature ovarian failure.
15236099 2004 [Inhibins and Activin A in hypertensive Disorders of Pregnancy and HELLP-Syndrome].
15227735 2004 G769A variation of inhibin alpha-gene in korean women with premature ovarian failure.
15214825 2004 Granular cell tumor: immunohistochemical assessment of inhibin-alpha, protein gene product 9.5, S100 protein, CD68, and Ki-67 proliferative index with clinical correlation.
15205401 2004 Mutational analysis of the mature peptide region of inhibin genes in Indian women with ovarian failure.
14967395 2004 Maternal serum inhibin A levels may predict pregnancy outcome in women with threatened abortion.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667886 2003 Measurement of inhibin A and inhibin pro-alphaC in early human pregnancy and their role in the prediction of pregnancy outcome in patients with recurrent pregnancy loss.
14596968 2003 Molecular analysis of isoniazid resistance in Mycobacterium tuberculosis isolates recovered from South Korea.
12857425 2003 Inhibin A, inhibin B and activin A concentrations in umbilical cord artery and vein.
12721183 2003 Characterization of plasma inhibin forms in fertile and infertile men.
12697670 2003 Differential binding and neutralization of activins A and B by follistatin and follistatin like-3 (FSTL-3/FSRP/FLRG).
12682233 2003 Regulation of activin A expression in mast cells and asthma: its effect on the proliferation of human airway smooth muscle cells.
12679471 2003 Control of follicle-stimulating hormone by estradiol and the inhibins: critical role of estradiol at the hypothalamus during the luteal-follicular transition.
12660265 2003 Changes in circulating concentrations of inhibins A and pro-alpha C during first trimester medical termination of pregnancy.
12651901 2003 Inhibin, activin, follistatin, activin receptors and beta-glycan gene expression in the placental tissue of patients with pre-eclampsia.
12587530 2002 Pre-eclampsia with fetal growth restriction: placental and serum activin A and inhibin A levels.
12576745 Elevated second-trimester maternal serum inhibin A levels in Asian pregnancies with fetal down syndrome and other chromosomal abnormalities.
12493718 2003 Immunolocalization of inhibin and activin alpha and betaB subunits and expression of corresponding messenger RNAs in the human adult testis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12456957 2002 The role of activin a in regulation of hemopoiesis.
12456605 2002 Circulating levels of inhibin A, activin A and follistatin in missed and recurrent miscarriages.
12385827 2002 Properties of inhibin binding to betaglycan, InhBP/p120 and the activin type II receptors.
12324653 2002 Activins, inhibins, and follistatins: from endocrinology to signaling. A paradigm for the new millennium.
12093833 2002 Mutation analysis of the inhibin alpha gene in a cohort of Italian women affected by ovarian failure.
11818495 2002 Hypermethylation of the inhibin alpha-subunit gene in prostate carcinoma.
11344232 2001 Inhibin/activin betaB-subunit expression in pheochromocytomas favors benign diagnosis.
11134153 2000 Localization of activin beta(A)-, beta(B)-, and beta(C)-subunits in humanprostate and evidence for formation of new activin heterodimers of beta(C)-subunit.
11098038 2000 Inhibin: a candidate gene for premature ovarian failure.
10865214 2000 Activin increases bone mass and mechanical strength of lumbar vertebrae in aged ovariectomized rats.
10746731 2000 Betaglycan binds inhibin and can mediate functional antagonism of activin signalling.
10320815 1999 A novel role of activin in inflammation and repair.
9506758 1998 Loss of the expression and localization of inhibin alpha-subunit in high grade prostate cancer.
9166111 1997 Development, validation and application of a two-site enzyme-linked immunosorbent assay for activin-AB.
9032295 1997 Activin and inhibin have antagonistic effects on ligand-dependent heteromerization of the type I and type II activin receptors and human erythroid differentiation.
8885240 1996 Characterization and determination of the biological activities of noncleavable high molecular weight forms of inhibin A and activin A.
8267637 1993 Activin A induces apoptotic cell death.
7890768 1995 Inhibin antagonizes inhibition of liver cell growth by activin by a dominant-negative mechanism.
3758355 1986 Human inhibin genes. Genomic characterisation and sequencing.
3754442 1986 Structure of two human ovarian inhibins.
3345731 1988 Inhibin: definition and nomenclature, including related substances.
3267209 1988 Erythroid differentiation factor is encoded by the same mRNA as that of the inhibin beta A chain.
3035540 1987 Characteristics of binding of human seminal alpha-inhibin-92 to human pituitary membranes.
3016724 1986 Inhibin A-subunit cDNAs from porcine ovary and human placenta.
2770810 1989 Inhibin as a marker for granulosa-cell tumors.
2767687 1989 Mapping of genes for inhibin subunits alpha, beta A, and beta B on human and mouse chromosomes and studies of jsd mice.
2575216 1989 Activin B: precursor sequences, genomic structure and in vitro activities.
2036994 1991 Follistatin binds to both activin and inhibin through the common subunit.
1448148 1992 Alpha-inhibin is a tumour-suppressor gene with gonadal specificity in mice.
1423490 1992 Immunolocalization of inhibin alpha-subunit in the human testis. A light- and electron-microscopy study.
1310063 1992 Effect of activin A on globin gene expression in purified human erythroid progenitors.