Property Summary

NCBI Gene PubMed Count 71
PubMed Score 63.88
PubTator Score 87.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2346 3.492 1.7

Expression

Gene RIF (59)

PMID Text
26544625 Data show that Ras protein regulates inhibitor of growth protein 4 (ING4)-thymine-DNA glycosylase (TDG)-Fas protein axis to promote apoptosis resistance in pancreatic cancer.
26278569 MiR-761 directly targeted ING4 and TIMP2.
25968091 This review summarizes the recent published literature that investigates the role of ING4 in regulating tumorigenesis and progression, and explores its potential for cancer treatment. [review]
25792601 SCF(JFK) as a bona fide E3 ligase for ING4 and unraveled the JFK-ING4-NF-kappaB axis as an important player in the development and progression of breast cancer
25790869 Data suggest a close connection between aberrant ING4 expression and the carcinogenesis of human bladder cells.
25571952 The enhanced antitumor activity generated by Ad.RGD-ING4-PTEN was closely associated with activation of the intrinsic and extrinsic apoptotic pathways and additive inhibition of tumor angiogenesis both in vitro and in vivo.
25490312 work suggests that ING4 can suppress osteosarcoma progression through signaling pathways such as mitochondria pathway and NF-kappaB signaling pathway and ING4 gene therapy is a promising approach to treating osteosarcoma.
24762396 loss of ING4, either directly or indirectly through loss of Pten, promotes Myc-driven prostate oncogenesis.
24157826 JWA has an important role in ING4-regulated melanoma angiogenesis, and ING4/JWA/ILK are promising prognostic markers and may be used as anti-angiogenic therapeutic targets for melanoma.
24130172 KAI1 overexpression increases ING4 expression in melanoma.
24057236 ING4 level elevation mediated proliferation and invasion inhibition may be tightly associated with the suppression of NF-kappaB signaling pathway.
23969950 these findings suggest that ING4 may be a feasible modulator for the MDR phenotype of gastric carcinoma cells
23967213 The ING4 Binding with p53 and Induced p53 Acetylation were Attenuated by Human Papillomavirus 16 E6.
23624912 ING4 acts as an E3 ubiquitin ligase to induce ubiquitination of p65 and degradation, which is critical to terminate NFkappaB activation.
23604125 These findings support a critical role for ING4 expression in normal cells in the non-cell-autonomous regulation of tumor growth.
23603392 ING4 may regulate c-MYC translation by its association with AUF1.
23504291 The low expression level of ING4 protein was correlated with high-risk gastrointestinal stromal tumors.
23181555 Report up-regulation of ING4 expression in sarcoid granulomas.
23056468 ING4 negatively regulates NF-kappaB in breast cancer
23055189 Loss of ING4 expression is associated with lymphatic metastasis in colon cancer.
22767438 Data suggested that miR-650 is correlated with the pathogenesis of hepatocellular carcinoma (HCC) and is involved in the HCC tumorigenesis process by inhibiting the expression of ING4.
22436625 Inhibitor of growth 4 may represent an important biomarker for assessing the severity of breast cancer
22334692 crystal structure of the ING4 N-terminal domain
22228137 Data suggest that ING4 may be a promising target for the treatment for ovarian cancer.
22078444 Mechanism of ING4 mediated inhibition of the proliferation and migration of human glioma cell line U251.
21971889 In this review, the different properties of ING4 are discussed, and its activities are correlated with different aspects of cell physiology. [Review]
21626442 Downregulated expression of inhibitor of growth 4 is associated with colorectal cancers.
21454715 Citrullination of inhibitor of growth 4 (ING4) by peptidylarginine deminase 4 (PAD4) disrupts the interaction between ING4 and p53
21315418 These results sustain the view that ING4 is a tumor suppressor in breast cancer and suggest that ING4 deletion may contribute to the pathogenesis of HER2-positive breast cancer.
21310648 results suggest that the decreases in nuclear ING4 may play important roles in tumorigenesis, progression and tumor differentiation in head and neck squamous cell carcinoma.
21177815 EBNA3C negatively regulate p53-mediated functions by interacting with ING4 and ING5.
21056991 ING4 is induced by BRMS1 and that it inhibits melanoma angiogenesis by suppressing NF-kappaB activity and IL-6 expression.
20716169 Demonstrated decreased ING4 mRNA and expression in 100% (50/50) lung tumour tissues. Furthermore, ING4 expression was lower in grade III than in grades I-II tumours. Reduced ING4 mRNA correlated with lymph node metastasis.
20707719 Loss of ING4 is associated with breast carcinoma.
20705953 Mutations in ING4 is associated with cancer.
20501848 A dominant mutant allele of the ING4 tumor suppressor found in human cancer cells exacerbates MYC-initiated mouse mammary tumorigenesis.
20381459 over-expression of miR-650 in gastric cancer may promote proliferation and growth of cancer cells, at least partially through directly targeting ING4.
20053357 results show that ING4 is a bivalent reader of the chromatin H3K4me3 modification and suggest a mechanism for enhanced targeting of the HBO1 complex to specific chromatin sites
19775294 our data suggest an essential role for ING-4 in human astrocytoma development and progression possibly through regulation of the NF-kappaB-dependent expression of genes involved in tumor invasion
19571607 ING4 has a potential role on the growth suppression and apoptosis enhancement in gliomas U87MG via the activation of mitochondrial-induced apoptotic pathway and the hindrance of the cell cycle progression.
19430401 ING4 has a potential role in growth suppression and apoptosis enhancement of melanoma through the activation of the mitochondrial-induced apoptotic pathway and the hindrance of the cell cycle. The deregulation of ING4 might be involved in melanomagenesis.
19250543 Report down-regulation of the inhibitor of growth family member 4 (ING4) in different forms of pulmonary fibrosis.
19034511 Findings suggest that exogenous ING4 can enhance A549 apoptosis via regulating the expression of Bcl-2 family proteins and the activation of mitochondrial apoptotic pathway.
18789575 HCC risk associated with heavy alcohol intake and current smoking differed by this polymorphism among CLD patients. IL-1B -31T/C polymorphism may modify HCC risk in relation to alcohol intake or smoking
18779315 ING4 may specifically regulate the activity of NF-kappaB molecules that are bound to target gene promoters.
18775696 Data suggest that the two wobble-splicing events at the exon 4-5 boundary influence subnuclear localization and degradation of ING4.
18399550 may play an inhibitory role in lung adenocarcinoma by up-regulation or down-regulation of cell proliferation-regulating proteins such as p27, cyclinD1, SKP2, and Cox2 by means of inactivation of Wnt-1/beta-catenin signaling
17848618 ING4 exerts an inhibitory effect on the production of proangiogenic molecules and consequently on MM-induced angiogenesis
17517644 provide evidence for the role of ING4 in mediating the effect of low K intake on renal outer medullary K channel activity by stimulation of p38 and ERK mitogen-activated protein kinase
17325660 data suggest that alternative splicing could modulate the activity of ING4 tumor suppressor protein
16973615 Splice variants of ING4 are associated with cell growth and motility of cancer cells
16096374 mediates the ability of HIF to activate transcription of its downstream target genes [review]
15935570 Frequent deletion and decreased mRNA expression of ING4 suggested it as a class two tumor suppressor gene and may play an important role in head and neck cancer.
15897452 ING4 represses activation of the hypoxia inducible factor.
15882981 NLS domain of ING4 is essential for the binding of ING4 to p53 and the function of ING4 associated with p53
15528276 detected deletion of the ING4 locus in 10-20% of human breast cancer cell lines and primary breast tumors, supporting the possibility that ING4 might be a tumor suppressor gene
15251430 ING4 induces G2/M cell cycle arrest and enhances the chemosensitivity to DNA-damage agents in HepG2 cells
15029197 In mice, xenografts of human glioblastoma U87MG, which has decreased expression of ING4, grow significantly faster and have higher vascular volume fractions than control tumours
12750254 p29ING4 and p28ING5 may be significant modulators of p53 function.

AA Sequence

MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEEKLALLKQIQE      1 - 70
AYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSDYDSSSSKGKKKGRTQKEKKA     71 - 140
ARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMI    141 - 210
GCDNPDCSIEWFHFACVGLTTKPRGKWFCPRCSQERKKK                                   211 - 249
//

Text Mined References (74)

PMID Year Title
26544625 2015 Oncogenic Ras suppresses ING4-TDG-Fas axis to promote apoptosis resistance.
26278569 2015 MiR-761 Promotes Progression and Metastasis of Non-Small Cell Lung Cancer by Targeting ING4 and TIMP2.
25968091 2015 The emerging role of inhibitor of growth 4 as a tumor suppressor in multiple human cancers.
25792601 2015 SCF(JFK) is a bona fide E3 ligase for ING4 and a potent promoter of the angiogenesis and metastasis of breast cancer.
25790869 2015 Reduced ING4 Expression Is Associated with the Malignancy of Human Bladder.
25571952 2015 Adenovirus-mediated ING4/PTEN double tumor suppressor gene co-transfer modified by RGD enhances antitumor activity in human nasopharyngeal carcinoma cells.
25490312 2014 Delivery of inhibitor of growth 4 (ING4) gene significantly inhibits proliferation and invasion and promotes apoptosis of human osteosarcoma cells.
25416956 2014 A proteome-scale map of the human interactome network.
24762396 2014 Transient induction of ING4 by Myc drives prostate epithelial cell differentiation and its disruption drives prostate tumorigenesis.
24157826 2013 ING4 regulates JWA in angiogenesis and their prognostic value in melanoma patients.
24130172 2014 Prognostic significance of KAI1/CD82 in human melanoma and its role in cell migration and invasion through the regulation of ING4.
24057236 2013 Tumor suppressor ING4 overexpression contributes to proliferation and invasion inhibition in gastric carcinoma by suppressing the NF-?B signaling pathway.
23969950 2013 Adenovirus-mediated ING4 expression reduces multidrug resistance of human gastric carcinoma cells in vitro and in vivo.
23967213 2013 The ING4 Binding with p53 and Induced p53 Acetylation were Attenuated by Human Papillomavirus 16 E6.
23624912 2014 Inhibitor of growth 4 induces NF?B/p65 ubiquitin-dependent degradation.
23604125 2014 ING4 regulates a secretory phenotype in primary fibroblasts with dual effects on cell proliferation and tumor growth.
23603392 2013 ING4 inhibits the translation of proto-oncogene MYC by interacting with AUF1.
23504291 2014 Low ING4 protein expression detected by paraffin-section immunohistochemistry is associated with poor prognosis in untreated patients with gastrointestinal stromal tumors.
23181555 2012 Expression of hypoxia-inducible factor (HIF)-1a-vascular endothelial growth factor (VEGF)-inhibitory growth factor (ING)-4- axis in sarcoidosis patients.
23056468 2012 Negative regulation of NF-?B by the ING4 tumor suppressor in breast cancer.
23055189 2012 ING4 is negatively correlated with microvessel density in colon cancer.
22767438 2013 Upregulation of miR-650 is correlated with down-regulation of ING4 and progression of hepatocellular carcinoma.
22436625 2012 Correlation between tumor suppressor inhibitor of growth family member 4 expression and microvessel density in breast cancer.
22334692 2012 Crystal structure of inhibitor of growth 4 (ING4) dimerization domain reveals functional organization of ING family of chromatin-binding proteins.
22228137 2012 Expression of tumor suppressor gene ING4 in ovarian carcinoma is correlated with microvessel density.
22078444 2011 [Mechanism of ING4 mediated inhibition of the proliferation and migration of human glioma cell line U251].
21971889 2012 Inhibitor of growth-4 mediates chromatin modification and has a suppressive effect on tumorigenesis and innate immunity.
21626442 2011 Downregulated expression of inhibitor of growth 4 (ING4) in advanced colorectal cancers: a non-randomized experimental study.
21454715 2011 Citrullination of inhibitor of growth 4 (ING4) by peptidylarginine deminase 4 (PAD4) disrupts the interaction between ING4 and p53.
21315418 2011 Deletion of the inhibitor of growth 4 (ING4) tumor suppressor gene is prevalent in human epidermal growth factor 2 (HER2)-positive breast cancer.
21310648 2011 Downregulation and translocation of nuclear ING4 is correlated with tumorigenesis and progression of head and neck squamous cell carcinoma.
21177815 2011 EBNA3C attenuates the function of p53 through interaction with inhibitor of growth family proteins 4 and 5.
21056991 2010 Cell cycle regulator ING4 is a suppressor of melanoma angiogenesis that is regulated by the metastasis suppressor BRMS1.
20716169 2010 Down-regulation of ING4 is associated with initiation and progression of lung cancer.
20707719 2010 Tumor-suppressive effect of adenovirus-mediated inhibitor of growth 4 gene transfer in breast carcinoma cells in vitro and in vivo.
20705953 2010 Functional impact of cancer-associated mutations in the tumor suppressor protein ING4.
20501848 2010 A dominant mutant allele of the ING4 tumor suppressor found in human cancer cells exacerbates MYC-initiated mouse mammary tumorigenesis.
20381459 2010 MicroRNA-650 targets ING4 to promote gastric cancer tumorigenicity.
20053357 2010 The dimeric structure and the bivalent recognition of H3K4me3 by the tumor suppressor ING4 suggests a mechanism for enhanced targeting of the HBO1 complex to chromatin.
19775294 2010 Loss of inhibitor of growth (ING-4) is implicated in the pathogenesis and progression of human astrocytomas.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19571607 2009 Inhibitor of growth 4 induces growth suppression and apoptosis in glioma U87MG.
19430401 2009 Inhibitor of growth 4 is involved in melanomagenesis and induces growth suppression and apoptosis in melanoma cell line M14.
19250543 2009 Down-regulation of the inhibitor of growth family member 4 (ING4) in different forms of pulmonary fibrosis.
19187765 2009 ING4 mediates crosstalk between histone H3 K4 trimethylation and H3 acetylation to attenuate cellular transformation.
19034511 2009 Inhibitor of growth 4 induces apoptosis in human lung adenocarcinoma cell line A549 via Bcl-2 family proteins and mitochondria apoptosis pathway.
18789575 2008 Adenovirus-mediated ING4 expression suppresses lung carcinoma cell growth via induction of cell cycle alteration and apoptosis and inhibition of tumor invasion and angiogenesis.
18779315 2008 The ING4 tumor suppressor attenuates NF-kappaB activity at the promoters of target genes.
18775696 2008 Two wobble-splicing events affect ING4 protein subnuclear localization and degradation.
18399550 2008 ING4 induces cell growth inhibition in human lung adenocarcinoma A549 cells by means of Wnt-1/beta-catenin signaling pathway.
18394746 2008 Widespread and subtle: alternative splicing at short-distance tandem sites.
18381289 2008 Molecular basis of histone H3K4me3 recognition by ING4.
17848618 2007 The new tumor-suppressor gene inhibitor of growth family member 4 (ING4) regulates the production of proangiogenic molecules by myeloma cells and suppresses hypoxia-inducible factor-1 alpha (HIF-1alpha) activity: involvement in myeloma-induced angiogenesis.
17517644 2007 Inhibitor of growth 4 (ING4) is up-regulated by a low K intake and suppresses renal outer medullary K channels (ROMK) by MAPK stimulation.
17325660 2007 Detection of novel mRNA splice variants of human ING4 tumor suppressor gene.
17157298 2006 Solution structure and NMR characterization of the binding to methylated histone tails of the plant homeodomain finger of the tumour suppressor ING4.
16973615 2006 Novel splice variants of ING4 and their possible roles in the regulation of cell growth and motility.
16920330 2006 Quantitative analysis of wobble splicing indicates that it is not tissue specific.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16728974 2006 ING2 PHD domain links histone H3 lysine 4 methylation to active gene repression.
16387653 2006 ING tumor suppressor proteins are critical regulators of chromatin acetylation required for genome expression and perpetuation.
16096374 2005 Regulation of HIF by prolyl hydroxylases: recruitment of the candidate tumor suppressor protein ING4.
15935570 2005 Frequent deletion and down-regulation of ING4, a candidate tumor suppressor gene at 12p13, in head and neck squamous cell carcinomas.
15897452 2005 The candidate tumor suppressor ING4 represses activation of the hypoxia inducible factor (HIF).
15882981 2005 Nuclear localization signal of ING4 plays a key role in its binding to p53.
15528276 2004 A screen for genes that suppress loss of contact inhibition: identification of ING4 as a candidate tumor suppressor gene in human cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15251430 2004 ING4 induces G2/M cell cycle arrest and enhances the chemosensitivity to DNA-damage agents in HepG2 cells.
15029197 2004 The candidate tumour suppressor protein ING4 regulates brain tumour growth and angiogenesis.
12750254 2003 p29ING4 and p28ING5 bind to p53 and p300, and enhance p53 activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.