Property Summary

NCBI Gene PubMed Count 23
PubMed Score 191.16
PubTator Score 12.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.422 2.3e-03
malignant mesothelioma 1.100 2.3e-06
glioblastoma 1.800 7.9e-06
osteosarcoma -1.895 5.7e-08
posterior fossa group A ependymoma 1.200 9.7e-08
medulloblastoma 1.400 6.3e-05
atypical teratoid / rhabdoid tumor 1.600 2.9e-07
medulloblastoma, large-cell 1.100 4.6e-03
primitive neuroectodermal tumor 1.700 9.7e-05
non-small cell lung cancer -1.160 1.0e-20
pediatric high grade glioma 1.700 1.9e-07
pilocytic astrocytoma 1.200 2.2e-06
lung adenocarcinoma -1.100 1.9e-11
Breast cancer -1.400 5.4e-11
ovarian cancer -1.800 9.4e-10
dermatomyositis 1.800 8.9e-05

Gene RIF (9)

PMID Text
25819753 ING3 levels may serve as a surrogate for growth rate, and suggest possible roles for ING3 in growth and self renewal and related diseases such as cancer.
24927342 Downregulated ING3 expression might play an important role in colorectal adenoma-adenocarcinoma sequence.
22550337 that ING3 may be an important marker for human hepatocellular carcinoma progression and prognosis, as well as a potential therapeutic target.
19935701 Data show that ING3 is degraded by the ubiquitin-proteasome pathway through the SCF(Skp2) complex.
19401682 Observational study of gene-disease association. (HuGE Navigator)
18081876 ING3 would function as a potential tumor suppressor molecule and that low levels of ING3 may indicate an aggressive nature of head and neck cancer.
17634537 ING3 may be an important marker for human melanoma progression and prognosis as well as a potential therapeutic target.
12545155 we have isolated a novel ING family gene, p47ING3, which modulates p53-mediated transcription, cell cycle control, and apoptosis. The p47ING3 gene is located at chromosome 7q31.3 and consists of 12 exons that encode 418 amino acids
12080476 Allelic loss and reduced expression of the ING3, a candidate tumor suppressor gene at 7q31, in human head and neck cancers.

AA Sequence

MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYY      1 - 70
KALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILERRSLELDTPSQPVNNHHAHS     71 - 140
HTPVEKRKYNPTSHHTTTDHIPEKKFKSEALLSTLTSDASKENTLGCRNNNSTASSNNAYNVNSSQPLGS    141 - 210
YNIGSLSSGTGAGAITMAAAQAVQATAQMKEGRRTSSLKASYEAFKNNDFQLGKEFSMARETVGYSSSSA    211 - 280
LMTTLTQNASSSAADSRSGRKSKNNNKSSSQQSSSSSSSSSLSSCSSSSTVVQEISQQTTVVPESDSNSQ    281 - 350
VDWTYDPNEPRYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQCTAAMKRRGSRHK      351 - 418
//

Text Mined References (27)

PMID Year Title
25819753 2015 ING3 protein expression profiling in normal human tissues suggest its role in cellular growth and self-renewal.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24927342 2014 Downregulated inhibitor of growth 3 (ING3) expression during colorectal carcinogenesis.
24463511 2014 ANP32E is a histone chaperone that removes H2A.Z from chromatin.
22550337 2012 Expression and prognostic value of ING3 in human primary hepatocellular carcinoma.
19935701 2010 The tumor suppressor ING3 is degraded by SCF(Skp2)-mediated ubiquitin-proteasome system.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19401682 2010 High-density SNP association study and copy number variation analysis of the AUTS1 and AUTS5 loci implicate the IMMP2L-DOCK4 gene region in autism susceptibility.
19154204 2009 Arabidopsis ING and Alfin1-like protein families localize to the nucleus and bind to H3K4me3/2 via plant homeodomain fingers.
18081876 2008 Downregulation of ING3 mRNA expression predicts poor prognosis in head and neck cancer.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17634537 2007 Prognostic significance of nuclear ING3 expression in human cutaneous melanoma.
16728974 2006 ING2 PHD domain links histone H3 lysine 4 methylation to active gene repression.
16387653 2006 ING tumor suppressor proteins are critical regulators of chromatin acetylation required for genome expression and perpetuation.
15647280 2005 The mammalian YL1 protein is a shared subunit of the TRRAP/TIP60 histone acetyltransferase and SRCAP complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15196461 2004 The highly conserved and multifunctional NuA4 HAT complex.
14966270 2004 Structural and functional conservation of the NuA4 histone acetyltransferase complex from yeast to humans.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12963728 2003 Identification of new subunits of the multiprotein mammalian TRRAP/TIP60-containing histone acetyltransferase complex.
12853948 2003 The DNA sequence of human chromosome 7.
12545155 2003 A novel PHD-finger motif protein, p47ING3, modulates p53-mediated transcription, cell cycle control, and apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12080476 2002 Allelic loss and reduced expression of the ING3, a candidate tumor suppressor gene at 7q31, in human head and neck cancers.
9847074 1998 Toward a complete human genome sequence.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.