Property Summary

NCBI Gene PubMed Count 84
PubMed Score 129.40
PubTator Score 240.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.900 3.0e-07
astrocytic glioma -1.200 3.8e-02
osteosarcoma -1.740 8.6e-05
glioblastoma -1.100 4.7e-03
sonic hedgehog group medulloblastoma 1.400 4.9e-06

Gene RIF (61)

PMID Text
26439691 ING1a acts as a novel link in the activation of the Rb pathway that can impose senescence in the absence of activating p53-mediated DNA damage signaling, and should prove useful in defining the molecular events contributing to Rb-induced senescence.
26306560 These data indicate that stromal ING1 expression can predict the survival of patients with luminal breast cancer
25613480 Overexpression of let-7b in gastric cancer can inhibit invasion and migration of gastric cancer cells through directly targeting the tumor metastasis-associated gene ING1.
25611387 ING1b finely regulates the hypoxic response by triggering HIF1alpha proteasomal degradation.
25411783 Results show that ING1 expression is under-regulated in pancreatic duct adenocarcinoma (PDAC) and is a direct target of miR-371-5p involved in miR-371-5p inducing promotion of PDAC cells proliferation.
24912621 Our results identify a novel functional relationship between cytoplasmic p33ING1b and oral squamous cell carcinoma patient survival
24903338 ING1b sumoylation regulates the binding of ING1b to the ISG15 and DGCR8 promoters, consequently regulating ISG15 and DGCR8 transcription.
24242916 Ing1b lacking cells showed decreased ability to repair the oxidized DNA.
24008732 ING1 translocates to the mitochondria of primary fibroblasts and established epithelial cell lines in response to apoptosis inducing stimuli, independent of the cellular p53 status.
23585863 Src may play a major role in regulating ING1 levels during tumorigenesis in those cancers in which high levels of Src expression or activity are present.
23472054 Data identify a pathway by which ING1a induces senescence and indicate that altered endocytosis activates the Rb pathway, subsequently effecting a senescent phenotype.
23462723 ING1b epigenetically regulates several miRNAs including miR-203.
23459830 ING1 acts at early stages of the DNA damage response activating a variety of repair mechanisms.
23388825 inhibitor of growth protein 1 (Ing1) is required for targeting active DNA demethylation
22260079 ING1 gene mutations are rare in laryngeal squamous cell carcinoma.
22237655 the reduced expression of p33(ING1b) in gastric adenocarcinoma tissues and gastric adenocarcinoma cell lines
21896275 Data show that overexpression of p33(ING1b) induces cellular senescence and upregulates p16(INK4a) expression in fibroblasts.
21779982 Data suggest that the combined detection of p33ING1, p53, and Beclin1 genes and proteins will be helpful for early diagnosis and prognosis judgment for NSCLC, and can provide experimental evidence for biotherapy of NSCLC.
21731648 ING1 stabilizes p53 by inhibiting polyubiquitination of multimonoubiquitinated forms via interaction with and colocalization of the HAUSP-deubiquitinase with p53.
21528065 Data show that ectopic expression of miR-622 promoted invasion, tumorigenesis and metastasis of gastric cancer cells, and that ING1 is a direct target of miR-622.
21432775 relocation of p33ING1b from the nucleus to the cytoplasm, where the protein is tethered by 14-3-3eta, participates in tumorigenesis and progression in HNSCC
21286670 Loss of ING1 is associated with non-small cell lung cancer.
21176536 AZT upregulates the expression of p33ING1b, a possible mechanism in regulating senescence and apoptosis of TJ905 cells.
21078114 p33ING1 triggers a senescent phenotype in cultured primary fibroblasts in a p53-dependent fashion.
20066899 ING1 proteins regulate the expression of proteins that are critical for angiogenesis in glioblastoma multiforme (GBM) such as the angiopoietins.
19680556 Observational study of gene-disease association. (HuGE Navigator)
19132896 Nuclear localization of ING1b is highly correlated with well-differentiated HCC cell lines whereas poorly differentiated HCC cells reveal nuclear exclusion, which is independent of p53 mutation status.
19085961 ING1 variants may modulate p53 activity and subsequently inhibit hepatoma cell growth by at least two possible mechanisms.
18836436 Tethering by laminin A stabilizes and targets the ING1 tumor suppressor.
18801192 Using across-species (yeast, fly, and human) bioinformatics-based approach, study shows that ING1 interacts specifically with the three proteins tested; p38MAPK, MEKK4 and RAD50.
18691180 Altered ratios of ING1 splicing isoforms may contribute to establishing the senescent phenotype.
18655775 ING1 binds karyopherin proteins and disruption of this interaction affects cell localization and ING activity as a transcriptional regulator.
18533182 Results show that both DNA repair and apoptotic activities of ING1 require the interaction of the C-terminal plant homeodomain (PHD) finger with histone H3 trimethylated at Lys4 (H3K4me3).
18450387 ING1b is up-regulated in hepatocellular carcinoma during the progression process and may contribute the alternation of general expression level of ING1
18388957 Data show that p33(ING1b) is degraded in the 20S proteasome and that NAD(P)H quinone oxidoreductase 1 (NQO1), previously shown to modulate the degradation of p53 in the 20S proteasome, inhibits the degradation of p33(ING1b).
17949449 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17929852 the interaction between Alien and the tumor suppressors p33ING1 and p33ING2 reveals a novel cellular protein network
17805569 The transfer of p33(ING1b) protein from the nucleus to the cytoplasm may result in loss of normal cellular function of the protein, which might play a role in the tumourigenesis and metastasis of oral squamous cell carcinoma
17585055 p33(ING1b) is a downstream target of the ATM/ATR response cascade to genotoxic stress. More importantly, our data indicate that the Ser-126 residue plays a key role in regulating the expression of cyclin B1 and proliferation of melanoma cells
17379210 ING1b acts as a chromatin accessibility factor for DNA damage recognition proteins upon genotoxic injury.
16607280 Interaction with p33ING1 represents a novel mechanism for the tumour suppression function of adp ribosylation factors.
16581770 Subcellular targeting of ING1 by phosphorylation-dependent 14-3-3 binding regulates P21 expression.
16465410 ING1 expression was up-regulated in all 7 lung cancer cell lines that had a p53 mutation.
16325212 p33ING1b prominently enhances etoposide-induced apoptosis through p53-dependent pathways in human osteosarcoma cells.
16273637 p33(ING1b) and p47(ING1a) mRNA expressions are closely related with the carcinogenesis and progression of human sporadic colorectal cancer
15800978 Loss or inactivation of p33(ING1b) normal function may be an important mechanism for the development of hepatocellular carcinoma retaining wild-type p53.
15677627 Down regulation of p33ING1b is associated with the pathogenesis of ovarian cancers
15662138 p33ING1b enhances taxol-induced apoptosis through p53-dependent pathway in human osteosarcoma cells; p33ING1b may be an important marker and/or therapeutic target in the prevention and treatment of osteosarcoma
15601862 p33ING1 expression induces features of cellular senescence through two silencing domains and interaction with Ras
15534913 Mutation and loss of expression are not the main reasons for the disfunction of p33(ING1b) in pancreatic carcinoma
15526165 ING tumor suppressors are involved in signalling pathways [review]
15375504 Decreased expression of the candidate tumor suppressor gene ING1 is associated with advanced neuroblastomas
15201991 ING1 mutations abrogate its enhancement in nucleotide excision repair in melanoma.
14676120 Deregulated expression and mislocalization of ING1 proteins are common events in gliomas and glioblastomas
14581367 ING1b gene expression plays an important role in carcinogenesis of non-small cell lung cancer
12637159 ING1 expression is frequently associated with adenocarcinoma of the esophagogastric junction tumorigenesis, further supporting its role as a tumor suppressor gene, and ING1 expression is independent of p53 status
12632089 overexpression and mutation of the ING1 gene are infrequent in human basal cell carcinoma
12243754 Data suggest that p33(ING1) cooperates with p53 in UVB-induced apoptosis via the mitochondrial cell death pathway in melanoma cells.
12015309 role in differential regulation of histone acetylation
12008079 PBLs from pts with haematological malignancies and controls expressed mainly the p33/ING1 transcript, with low levels of p24/ING1 and p33/ING1 mRNA were found. Genetic changes in p33/ING1 play no role in these malignancies.
11991811 ING1 in normal and neoplastic tissues.

AA Sequence

MSFVECPYHSPAERLVAEADEGGPSAITGMGLCFRCLLFSFSGRSGVEGGRVDLNVFGSLGLQPWIGSSR      1 - 70
CWGGPCSSALRCGWFSSWPPPSKSAIPIGGGSRGAGRVSRWPPPHWLEAWRVSPLPLSPLSPATFGRGFI     71 - 140
AVAVIPGLWARGRGCSSDRLPRPAGPARRQFQAASLLTRGWGRAWPWKQILKELDECYERFSRETDGAQK    141 - 210
RRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGE    211 - 280
AAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDP    281 - 350
NEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAY    351 - 420
NR                                                                        421 - 422
//

Text Mined References (88)

PMID Year Title
26439691 2015 Aging with ING: a comparative study of different forms of stress induced premature senescence.
26306560 2015 Stromal ING1 expression induces a secretory phenotype and correlates with breast cancer patient survival.
25613480 2015 MicroRNA let-7b suppresses human gastric cancer malignancy by targeting ING1.
25611387 2015 ING1b negatively regulates HIF1? protein levels in adipose-derived stromal cells by a SUMOylation-dependent mechanism.
25411783 2014 MiR-371-5p facilitates pancreatic cancer cell proliferation and decreases patient survival.
24912621 2014 Tumor cell apoptosis mediated by cytoplasmic ING1 is associated with improved survival in oral squamous cell carcinoma patients.
24903338 2014 SUMOylation of the ING1b tumor suppressor regulates gene transcription.
24242916 2014 Tumor suppressor Ing1b facilitates DNA repair and prevents oxidative stress induced cell death.
24008732 2013 ING1 induces apoptosis through direct effects at the mitochondria.
23585863 2013 Src regulates the activity of the ING1 tumor suppressor.
23472054 2013 The ING1a tumor suppressor regulates endocytosis to induce cellular senescence via the Rb-E2F pathway.
23462723 2013 ING1b-inducible microRNA203 inhibits cell proliferation.
23459830 2013 Inhibitor of growth 1 (ING1) acts at early steps of multiple DNA repair pathways.
23388825 2013 Ing1 functions in DNA demethylation by directing Gadd45a to H3K4me3.
22419112 2012 Nucleolar protein CSIG is required for p33ING1 function in UV-induced apoptosis.
22260079 2011 [Mutation of ING1 gene in laryngeal squamous cell carcinoma and its association with p33ING1b protein expression].
22237655 2012 Adenovirus-mediated expression of p33(ING1b) induces apoptosis and inhibits proliferation in gastric adenocarcinoma cells in vitro.
21896275 2011 The tumor suppressor p33ING1b upregulates p16INK4a expression and induces cellular senescence.
21779982 2011 The expression of p33(ING1), p53, and autophagy-related gene Beclin1 in patients with non-small cell lung cancer.
21731648 2011 The p53 tumor suppressor is stabilized by inhibitor of growth 1 (ING1) by blocking polyubiquitination.
21528065 2011 Down-regulation of miR-622 in gastric cancer promotes cellular invasion and tumor metastasis by targeting ING1 gene.
21432775 2011 Cytoplasmic expression of p33ING1b is correlated with tumorigenesis and progression of head and neck squamous cell carcinoma.
21286670 2011 Genetic alterations of tumor suppressor ING1 in human non-small cell lung cancer.
21176536 2010 [Effects of azidothymidine on p33ING1b expression, apoptosis and senescence of TJ905 human glioblastoma cell line].
21078114 2011 The tumor suppressor ING1 contributes to epigenetic control of cellular senescence.
20066899 2009 The inhibitor of growth 1 (ING1) proteins suppress angiogenesis and differentially regulate angiopoietin expression in glioblastoma cells.
19680556 2009 Genetic variation in healthy oldest-old.
19132896 2009 Nuclear exclusion of p33ING1b tumor suppressor protein: explored in HCC cells using a new highly specific antibody.
19085961 2009 Human inhibitor of growth 1 inhibits hepatoma cell growth and influences p53 stability in a variant-dependent manner.
18836436 2008 Tethering by lamin A stabilizes and targets the ING1 tumour suppressor.
18801192 2008 Interspecies data mining to predict novel ING-protein interactions in human.
18691180 2008 ING1a expression increases during replicative senescence and induces a senescent phenotype.
18655775 2008 ING1 protein targeting to the nucleus by karyopherins is necessary for activation of p21.
18533182 2008 Histone H3K4me3 binding is required for the DNA repair and apoptotic activities of ING1 tumor suppressor.
18450387 2009 ING1a and ING1b different expressed in sporadic hepatocellular carcinoma.
18388957 2008 NAD(P)H quinone oxidoreductase 1 inhibits the proteasomal degradation of the tumour suppressor p33(ING1b).
17949449 2008 The predictive value of p53 and p33(ING1b) in patients with Dukes'C colorectal cancer.
17929852 2007 The tumor suppressors p33ING1 and p33ING2 interact with alien in vivo and enhance alien-mediated gene silencing.
17805569 2008 Nuclear to cytoplasmic shift of p33(ING1b) protein from normal oral mucosa to oral squamous cell carcinoma in relation to clinicopathological variables.
17585055 2007 Phosphorylation of the tumor suppressor p33(ING1b) at Ser-126 influences its protein stability and proliferation of melanoma cells.
17379210 2007 The ING1b tumor suppressor facilitates nucleotide excision repair by promoting chromatin accessibility to XPA.
16728974 2006 ING2 PHD domain links histone H3 lysine 4 methylation to active gene repression.
16607280 2006 A functional link between the tumour suppressors ARF and p33ING1.
16581770 2006 Subcellular targeting of p33ING1b by phosphorylation-dependent 14-3-3 binding regulates p21WAF1 expression.
16465410 2006 Alterations in novel candidate tumor suppressor genes, ING1 and ING2 in human lung cancer.
16325212 2006 The p33ING1b tumor suppressor cooperates with p53 to induce apoptosis in response to etoposide in human osteosarcoma cells.
16273637 2005 Genetic alterations and expression of inhibitor of growth 1 in human sporadic colorectal cancer.
15800978 2005 Inhibitory effect of tumor suppressor p33(ING1b) and its synergy with p53 gene in hepatocellular carcinoma.
15677627 2005 Epigenetic and genetic alterations of p33ING1b in ovarian cancer.
15662138 2005 The tumor suppressor p33ING1b enhances taxol-induced apoptosis by p53-dependent pathway in human osteosarcoma U2OS cells.
15601862 2005 Growth inhibition by the tumor suppressor p33ING1 in immortalized and primary cells: involvement of two silencing domains and effect of Ras.
15534913 2004 Genetic alterations and reduced expression of tumor suppressor p33(ING1b) in human exocrine pancreatic carcinoma.
15526165 2004 Biological functions of the ING family tumor suppressors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15451426 2004 Identification of a novel BRMS1-homologue protein p40 as a component of the mSin3A/p33(ING1b)/HDAC1 deacetylase complex.
15375504 2004 Decreased expression of the candidate tumor suppressor gene ING1 is associated with poor prognosis in advanced neuroblastomas.
15201991 2004 Mutations of the ING1 tumor suppressor gene detected in human melanoma abrogate nucleotide excision repair.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676120 2003 Altered subcellular localization and low frequency of mutations of ING1 in human brain tumors.
14665632 2004 Components of a pathway maintaining histone modification and heterochromatin protein 1 binding at the pericentric heterochromatin in Mammalian cells.
14581367 2003 Reduced ING1b gene expression plays an important role in carcinogenesis of non-small cell lung cancer patients.
12963728 2003 Identification of new subunits of the multiprotein mammalian TRRAP/TIP60-containing histone acetyltransferase complex.
12637159 2003 ING1 and p53 tumor suppressor gene alterations in adenocarcinomas of the esophagogastric junction.
12632089 2003 Analyses of the tumour suppressor ING1 expression and gene mutation in human basal cell carcinoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12243754 2002 p33(ING1) enhances UVB-induced apoptosis in melanoma cells.
12208736 2002 The candidate tumor suppressor ING1b can stabilize p53 by disrupting the regulation of p53 by MDM2.
12147653 2002 Loss of nuclear expression of the p33(ING1b) inhibitor of growth protein in childhood acute lymphoblastic leukaemia.
12015309 2002 Human ING1 proteins differentially regulate histone acetylation.
11991811 2002 Comparative assessment expression of the inhibitor of growth 1 gene (ING1) in normal and neoplastic tissues.
11784859 2002 Role of the Sin3-histone deacetylase complex in growth regulation by the candidate tumor suppressor p33(ING1).
11682605 2001 UV-induced binding of ING1 to PCNA regulates the induction of apoptosis.
11481424 2001 DNA damage-inducible gene p33ING2 negatively regulates cell proliferation through acetylation of p53.
11118440 2001 Differential association of products of alternative transcripts of the candidate tumor suppressor ING1 with the mSin3/HDAC1 transcriptional corepressor complex.
10866301 2000 Genomic structure of the human ING1 gene and tumor-specific mutations detected in head and neck squamous cell carcinomas.
10807544 2000 p24/ING1-ALT1 and p47/ING1-ALT2, distinct alternative transcripts of p33/ING1.
10779953 [Genomic organization of the suppressor gene for tumor growth ING1].
10754201 2000 Diminished expression of ING1 mRNA and the correlation with p53 expression in breast cancers.
10679922 2000 Molecular analysis of the candidate tumor suppressor gene ING1 in human head and neck tumors with 13q deletions.
10626813 1999 Cancer-testis antigens and ING1 tumor suppressor gene product are breast cancer antigens: characterization of tissue-specific ING1 transcripts and a homologue gene.
10554029 1999 Adenovirus-mediated transfer of p33ING1 with p53 drastically augments apoptosis in gliomas.
9440695 1998 The candidate tumour suppressor p33ING1 cooperates with p53 in cell growth control.
9330636 1997 Localization of the candidate tumor suppressor gene ING1 to human chromosome 13q34.
9186514 1997 Cellular localization and chromosome mapping of a novel candidate tumor suppressor gene (ING1).
9121449 1997 Extension of the replicative life span of human diploid fibroblasts by inhibition of the p33ING1 candidate tumor suppressor.
9102209 1997 A novel candidate tumor suppressor, ING1, is involved in the regulation of apoptosis.
8944021 1996 Suppression of the novel growth inhibitor p33ING1 promotes neoplastic transformation.