Property Summary

NCBI Gene PubMed Count 46
PubMed Score 96.02
PubTator Score 67.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.400 3.7e-02
oligodendroglioma -1.400 3.3e-02
group 3 medulloblastoma 1.900 9.4e-04
non-small cell lung cancer 1.011 3.1e-14
intraductal papillary-mucinous neoplasm ... 1.300 2.0e-03
lung cancer 1.100 1.0e-03
non primary Sjogren syndrome sicca -1.100 2.0e-02
inflammatory breast cancer 1.200 1.5e-02
ulcerative colitis 1.100 2.9e-04

Gene RIF (19)

PMID Text
26460953 Data unveils a novel mechanism of PRMT1-mediated CPC regulation through methylation of INCENP.
25586992 The data suggest that INCENP in the chromosomal passenger complex pathway contributes to estrogen receptor-negative breast cancer susceptibility in the European population.
23848594 Our results provide the structural basis and energetics of the human Aurora-A(G198N) - INCENP complex
23562843 v-Src induces the failure of cytokinesis and the delocalization of Mklp1, Aurora B, and INCENP from the spindle midzone.
21875947 HIV-1 Vpr interferes with the heterochromatin structure by displacing HP1-alpha and HP1-gamma proteins in interphase, which leads to relocalization of the centromere chromatin proteins Mis12, Sgo1, and INCENP/CPC after prophase
21346195 HP1alpha binding by INCENP or Shugoshin 1 (Sgo1) is dispensable for centromeric cohesion protection during mitosis of human cells, but might regulate yet unknown interphase functions of the chromosome passenger complex (CPC) or Sgo1 at the centromeres.
20619651 Dephosphorylation of INCENP at anaphase and the concomitant relocation of the chromosomal passenger protein complex prevents kinetochore recruitment of mitotic checkpoint proteins.
20372054 Results indicate that INCENP-Aurora B localized at centromeres/inner kinetochores is sufficient to mediate SAC activity upon spindle disruption.
19494039 Data show that binding to INCENP is alone critical to the distinct function of Aurora B, and although G198 of Aurora A is required for TPX2 binding, N142G Aurora B retains INCENP binding and Aurora B function.
18752045 High INCENP expression is associated with high grade non-Hodgkin B-cell lymphomas.
17956729 Borealin and INCENP associate with the helical domain of Survivin to form a tight three-helical bundle.
17623812 protein truncation and in vitro mutagenesis,have identified the nucleolar localization sequences on INCENP
16571674 A functional module within the chromosomal passenger complex involving the inner centromere protein INCENP, Survivin, and Borealin.
16378098 INCENP phosphorylation by Cdk1 is necessary for the recruitment of Plk1 to the kinetochore.
16239925 Data show that INCENP has an important role in stabilizing the chromosomal passenger complex, and that Borealin acts to promote binding of Survivin to INCENP.
15917996 Aurora-C is a chromosomal passenger protein that disrupts the association of INCENP with Aurora-B and may serve as a key regulator in cell division
15796717 Recruitment of MKLP1 to the midzone/midbody by INCENP is a crucial step for the midbody formation and completion of cytokinesis in mammalian cells.
15316025 association with inner centromere protein (INCENP) activates the novel chromosomal passenger protein, Aurora-C
12925766 Aurora B kinase activity is stimulated by INCENP and C-terminal region of INCENP is sufficient for activation

AA Sequence

MGTTAPGPIHLLELCDQKLMEFLCNMDNKDLVWLEEIQEEAERMFTREFSKEPELMPKTPSQKNRRKKRR      1 - 70
ISYVQDENRDPIRRRLSRRKSRSSQLSSRRLRSKDSVEKLATVVGENGSVLRRVTRAAAAAAAATMALAA     71 - 140
PSSPTPESPTMLTKKPEDNHTQCQLVPVVEIGISERQNAEQHVTQLMSTEPLPRTLSPTPASATAPTSQG    141 - 210
IPTSDEESTPKKSKARILESITVSSLMATPQDPKGQGVGTGRSASKLRIAQVSPGPRDSPAFPDSPWRER    211 - 280
VLAPILPDNFSTPTGSRTDSQSVRHSPIAPSSPSPQVLAQKYSLVAKQESVVRRASRRLAKKTAEEPAAS    281 - 350
GRIICHSYLERLLNVEVPQKVGSEQKEPPEEAEPVAAAEPEVPENNGNNSWPHNDTEIANSTPNPKPAAS    351 - 420
SPETPSAGQQEAKTDQADGPREPPQSARRKRSYKQAVSELDEEQHLEDEELQPPRSKTPSSPCPASKVVR    421 - 490
PLRTFLHTVQRNQMLMTPTSAPRSVMKSFIKRNTPLRMDPKCSFVEKERQRLENLRRKEEAEQLRRQKVE    491 - 560
EDKRRRLEEVKLKREERLRKVLQARERVEQMKEEKKKQIEQKFAQIDEKTEKAKEERLAEEKAKKKAAAK    561 - 630
KMEEVEARRKQEEEARRLRWLQQEEEERRHQELLQKKKEEEQERLRKAAEAKRLAEQREQERREQERREQ    631 - 700
ERREQERREQERREQERQLAEQERRREQERLQAERELQEREKALRLQKEQLQRELEEKKKKEEQQRLAER    701 - 770
QLQEEQEKKAKEAAGASKALNVTVDVQSPACTSYQMTPQGHRAPPKINPDNYGMDLNSDDSTDDEAHPRK    771 - 840
PIPTWARGTPLSQAIIHQYYHPPNLLELFGTILPLDLEDIFKKSKPRYHKRTSSAVWNSPPLQGARVPSS    841 - 910
LAYSLKKH                                                                  911 - 918
//

Text Mined References (56)

PMID Year Title
26460953 2015 PRMT1 promotes mitosis of cancer cells through arginine methylation of INCENP.
25586992 2015 Inherited variants in the inner centromere protein (INCENP) gene of the chromosomal passenger complex contribute to the susceptibility of ER-negative breast cancer.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
23848594 2013 Structural basis for binding of aurora-AG198N- INCENP complex: MD simulations and free energy calculations.
23562843 2013 v-Src causes delocalization of Mklp1, Aurora B, and INCENP from the spindle midzone during cytokinesis failure.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21829377 2011 Genetic loci associated with plasma phospholipid n-3 fatty acids: a meta-analysis of genome-wide association studies from the CHARGE Consortium.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21346195 2011 Mitotic centromeric targeting of HP1 and its binding to Sgo1 are dispensable for sister-chromatid cohesion in human cells.
21225229 2011 PAR, a protein involved in the cell cycle, is functionally related to chromosomal passenger proteins.
21051298 2011 Spatio-temporal composition of the mitotic Chromosomal Passenger Complex detected using in situ proximity ligation assay.
20619651 2010 Relocation of the chromosomal passenger complex prevents mitotic checkpoint engagement at anaphase.
20562864 2010 Human POGZ modulates dissociation of HP1alpha from mitotic chromosome arms through Aurora B activation.
20372054 2010 Centromere localization of INCENP-Aurora B is sufficient to support spindle checkpoint function.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19494039 2009 Molecular distinctions between Aurora A and B: a single residue change transforms Aurora A into correctly localized and functional Aurora B.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18752045 2009 INCENP (inner centromere protein) is overexpressed in high grade non-Hodgkin B-cell lymphomas.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17956729 2007 Structure of a Survivin-Borealin-INCENP core complex reveals how chromosomal passengers travel together.
17681274 2007 Cell death in leukemia: passenger protein regulation by topoisomerase inhibitors.
17623812 2007 Centromere RNA is a key component for the assembly of nucleoproteins at the nucleolus and centromere.
17099693 2006 The Survivin-Crm1 interaction is essential for chromosomal passenger complex localization and function.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16764853 2006 EVI5 protein associates with the INCENP-aurora B kinase-survivin chromosomal passenger complex and is involved in the completion of cytokinesis.
16760428 2006 Phosphorylation- and polo-box-dependent binding of Plk1 to Bub1 is required for the kinetochore localization of Plk1.
16571674 2006 Centromere targeting of the chromosomal passenger complex requires a ternary subcomplex of Borealin, Survivin, and the N-terminal domain of INCENP.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16378098 2006 Complex formation of Plk1 and INCENP required for metaphase-anaphase transition.
16239925 2006 Survivin mediates targeting of the chromosomal passenger complex to the centromere and midbody.
15917996 2005 Overexpression of an Aurora-C kinase-deficient mutant disrupts the Aurora-B/INCENP complex and induces polyploidy.
15796717 2005 Recruitment of MKLP1 to the spindle midzone/midbody by INCENP is essential for midbody formation and completion of cytokinesis in human cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15316025 2004 Direct association with inner centromere protein (INCENP) activates the novel chromosomal passenger protein, Aurora-C.
15249581 2004 Borealin: a novel chromosomal passenger required for stability of the bipolar mitotic spindle.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14610074 2004 Aurora-B phosphorylation in vitro identifies a residue of survivin that is essential for its localization and binding to inner centromere protein (INCENP) in vivo.
12925766 2003 Exploring the functional interactions between Aurora B, INCENP, and survivin in mitosis.
12660166 2003 Pericentric heterochromatin becomes enriched with H2A.Z during early mammalian development.
12584241 2003 Dynamic relocalization of the chromosomal passenger complex proteins inner centromere protein (INCENP) and aurora-B kinase during male mouse meiosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11516652 2001 INCENP is required for proper targeting of Survivin to the centromeres and the anaphase spindle during mitosis.
11453556 2001 Human INCENP colocalizes with the Aurora-B/AIRK2 kinase on chromosomes and is overexpressed in tumour cells.
11139336 2001 INCENP binds directly to tubulin and requires dynamic microtubules to target to the cleavage furrow.
11084331 2000 Survivin and the inner centromere protein INCENP show similar cell-cycle localization and gene knockout phenotype.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10369859 1999 Defective chromosome segregation, microtubule bundling and nuclear bridging in inner centromere protein gene (Incenp)-disrupted mice.
9914378 1998 Colocalization of TD-60 and INCENP throughout G2 and mitosis: evidence for their possible interaction in signalling cytokinesis.
9864353 1998 INCENP centromere and spindle targeting: identification of essential conserved motifs and involvement of heterochromatin protein HP1.
8088460 1994 Role of nonhistone proteins in the chromosomal events of mitosis.
1860899 1991 Analysis of the distribution of the INCENPs throughout mitosis reveals the existence of a pathway of structural changes in the chromosomes during metaphase and early events in cleavage furrow formation.