Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.06
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession C9JVW0
Symbols PRR24

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MRGTSCVGGGAESPGGAGLSEGPRGRWLRLAPVCAYFLCVSLAAVLLAVYYGLIWVPTRSPAAPAGPQPS      1 - 70
APSPPCAARPGVPPVPAPAAASLSCLLGVPGGPRPQLQLPLSRRRRYSDPDRRPSRQTPRETPEAAEGRR     71 - 140
PG                                                                        141 - 142
//

Text Mined References (3)

PMID Year Title