Property Summary

NCBI Gene PubMed Count 29
PubMed Score 105.20
PubTator Score 201.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 1.500 6.0e-06
astrocytoma -2.600 3.4e-02
psoriasis 3.000 4.2e-162
cutaneous lupus erythematosus 1.200 2.8e-02
glioblastoma -3.500 1.3e-08
oligodendroglioma -1.200 3.1e-04
osteosarcoma 1.400 4.6e-03
ependymoma -5.100 1.0e-23
atypical teratoid/rhabdoid tumor -2.900 3.6e-07
interstitial cystitis -1.500 2.7e-04
cystic fibrosis 1.500 2.5e-04
adult high grade glioma -4.000 2.4e-07
pilocytic astrocytoma -4.800 6.5e-18
lung carcinoma 6.100 2.4e-72
Pick disease -1.800 2.4e-02

Gene RIF (15)

PMID Text
26233522 It is a neuronal marker, and has been indicated as an immunohistochemical surrogate of chromosome 1p/19q co-deletion in oligodendroglial tumors.
25236435 Gonadotropinomas, null cell pituitary adenomas, and thyrotropinomas exhibit high levels of intracellular INA protein indicating neuronal transdifferentiation.
24483152 alpha-Internexin was expressed in 53% of 350 pancreatic neuroendocrine tumors. Reduced expression of alpha-internexin was significantly associated with advanced stage metastases, recurrence and shorter overall survival.
24197863 It is a supportive diagnostic marker for oligodendroglial tumors with the 1p/19q co-deletion.
23125841 Tandem affinity purification and mass spectrometry analysis identify internexin neuronal intermediate filament protein alpha unit (INA), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22890969 High INA expression is associated with grade II gliomas.
21990041 INA may provide additional biologic information relevant to delineation of both pancreatic neuroendocrine neoplasms (NEN) tumor phenotypes and clinical behavior.
20213320 the importance of alpha-internexin and NF-L in regulating the conformations of NF-M and NF-H
19139367 Alpha-Internexin (INA) expression appears to be a simple, reliable prognostic marker and a surrogate marker of 1p19q codeletion.
19110265 This protein has been found differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
18528283 Expression of the 2 markers, alpha-internexin and peripherin, in a small round cell tumor strongly favors the diagnosis of neuroblastoma.
16722980 Abnormal neuronal intermediate filament inclusions of alpha-internexin have been identified as the pathological hallmark of neuronal intermediate filament inclusion disease
16385451 Observational study of gene-disease association. (HuGE Navigator)
15161649 The discovery of alpha-internexin in the cytoplasmic inclusions implicates novel mechanisms of pathogenesis in inclusion diseeae and other neurological diseases with pathological accumulations of IFs.
12209604 alpha-internexin expression in neuroblastoma

AA Sequence

MSFGSEHYLCSSSSYRKVFGDGSRLSARLSGAGGAGGFRSQSLSRSNVASSAACSSASSLGLGLAYRRPP      1 - 70
ASDGLDLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNRALEAELAALRQRHAEPSRVG     71 - 140
ELFQRELRDLRAQLEEASSARSQALLERDGLAEEVQRLRARCEEESRGREGAERALKAQQRDVDGATLAR    141 - 210
LDLEKKVESLLDELAFVRQVHDEEVAELLATLQASSQAAAEVDVTVAKPDLTSALREIRAQYESLAAKNL    211 - 280
QSAEEWYKSKFANLNEQAARSTEAIRASREEIHEYRRQLQARTIEIEGLRGANESLERQILELEERHSAE    281 - 350
VAGYQDSIGQLENDLRNTKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTSGLSISGLNPL    351 - 420
PNPSYLLPPRILSATTSKVSSTGLSLKKEEEEEEASKVASKKTSQIGESFEEILEETVISTKKTEKSNIE    421 - 490
ETTISSQKI                                                                 491 - 499
//

Text Mined References (33)

PMID Year Title
26233522 2015 Coexpression of cyclin D1 and alpha-internexin in oligodendroglial tumors.
25236435 2015 Expression pattern of neuronal intermediate filament ?-internexin in anterior pituitary gland and related tumors.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24483152 2014 ?-Internexin: a novel biomarker for pancreatic neuroendocrine tumor aggressiveness.
24197863 2014 Alpha-internexin and altered CIC expression as a supportive diagnostic marker for oligodendroglial tumors with the 1p/19q co-deletion.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
22926577 2012 Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis.
22890969 2012 Molecular genetics of adult grade II gliomas: towards a comprehensive tumor classification system.
22683712 2012 Genome-wide association analysis identifies susceptibility loci for migraine without aura.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21990041 2012 The clinical implications and biologic relevance of neurofilament expression in gastroenteropancreatic neuroendocrine neoplasms.
20213320 2010 How the projection domains of NF-L and alpha-internexin determine the conformations of NF-M and NF-H in neurofilaments.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19139367 2009 alpha-Internexin expression identifies 1p19q codeleted gliomas.
19110265 2009 Proteomic analysis of dorsolateral prefrontal cortex indicates the involvement of cytoskeleton, oligodendrocyte, energy metabolism and new potential markers in schizophrenia.
18528283 2008 A comparative immunohistochemical analysis of small round cell tumors of childhood: utility of peripherin and alpha-internexin as markers for neuroblastomas.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16722980 2006 Topography of alpha-internexin-positive neuronal aggregates in 10 patients with neuronal intermediate filament inclusion disease.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15673434 2005 A novel scaffold protein, TANC, possibly a rat homolog of Drosophila rolling pebbles (rols), forms a multiprotein complex with various postsynaptic density proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15161649 2004 alpha-internexin is present in the pathological inclusions of neuronal intermediate filament inclusion disease.
15121898 2004 The composition of Staufen-containing RNA granules from human cells indicates their role in the regulated transport and translation of messenger RNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12209604 2002 Novel products of the HUD, HUC, NNP-1 and alpha-internexin genes identified by autologous antibody screening of a pediatric neuroblastoma library.
10862698 2000 Proteomic analysis of NMDA receptor-adhesion protein signaling complexes.
9435256 1998 Specific interaction of HTLV tax protein and a human type IV neuronal intermediate filament protein.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7769995 1995 Cloning and developmental expression of human 66 kd neurofilament protein.
7690783 1993 Expression of neuronal and glial polypeptides during histogenesis of the human cerebellar cortex including observations on the dentate nucleus.
2201753 1990 Alpha-internexin, a novel neuronal intermediate filament protein, precedes the low molecular weight neurofilament protein (NF-L) in the developing rat brain.