Property Summary

NCBI Gene PubMed Count 57
PubMed Score 85.38
PubTator Score 83.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.920 6.6e-04
Multiple myeloma 2.273 1.0e-03
cutaneous lupus erythematosus -1.200 1.5e-02
psoriasis 1.300 3.8e-04
astrocytoma 1.100 6.4e-17
oligodendroglioma 1.200 2.0e-12
sonic hedgehog group medulloblastoma 1.700 5.1e-07
atypical teratoid / rhabdoid tumor 1.100 3.3e-04
medulloblastoma, large-cell 1.900 1.1e-05
acute quadriplegic myopathy 1.349 1.0e-07
primary pancreatic ductal adenocarcinoma -1.335 2.0e-04
intraductal papillary-mucinous neoplasm ... -1.900 1.6e-04
lung cancer 2.500 2.1e-03
colon cancer 1.200 3.1e-02
diabetes mellitus -1.300 3.8e-03
posterior fossa group A ependymoma 1.100 9.6e-08
ovarian cancer 2.100 9.1e-04
pancreatic cancer -1.200 2.8e-04

Protein-protein Interaction (5)

Gene RIF (38)

PMID Text
25465060 The findings suggest that overexpressed IMPDH2 can be used as a biomarker for kidney and bladder cancer diagnosis and is a potential therapeutic target for the diseases
25392102 IMPDH2 is directly involved in the development of chemoresistance and radioresistance in osteosarcoma cells.
25105143 Expression of IMPDH mRNA after mycophenolate administration in male volunteers.
24980853 the localization of IMPDH2 inside the nucleus of human cells as well as the ultrastructure of R&R inclusions
24659377 Compared with non-cancerous prostate tissues, IMPDH2 mRNA and protein expression levels were both significantly upregulated in prostate cancer tissues.
24477477 Rods and rings (RR) are protein assemblies composed of CTPS1 and IMPDH2. Glutamine deprivation initiates reversible assembly of mammalian rods and rings.
23166591 Expression of HIV-1 Tat upregulates the abundance of IMP (inosine 5'-monophosphate) dehydrogenase 2 (IMPDH2) in the nucleoli of Jurkat T-cells
22928911 An insight to the dynamics of conserved water-mediated salt bridge interaction and interdomain recognition in hIMPDH isoforms.
22066532 Role of salt bridge dynamics in inter domain recognition of human IMPDH isoforms: an insight to inhibitor topology for isoform-II.
22029192 Anti-IMPDH2 may cause difficulties in interpretation of immunofluorescence patterns in routine autoantibody testing.
21996196 the 3757C allele was associated with higher lymphocyte counts and a reduced incidence of lymphopenia among kidney allograft recipients
21460227 IMPDHII plays an important role in the negative regulation of TLR2 signaling by modulating PI3K activity.
21181270 This ethnic-related data might contribute to a better understanding of the variability in clinical outcome and/or dose adjustments of drugs that are IMPDH inhibitors such as mycophenolic acid.
20808934 IMPDH2 is directly involved in the development of chemoresistance in osteosarcoma cells
20718729 resequenced IMPDH1 and IMPDH2 using DNA from 288 individuals from three ethnic groups and performed functional genomic studies of the sequence variants observed; identfied 25 SNPs, 24 novel, in IMPDH2
20679962 Potential associations between the most frequent single nucleotide polymorphisms in both IMPDH genes and clinical outcome in renal transplant recipients.
20679962 Observational study of gene-disease association. (HuGE Navigator)
20135634 in the absence of ligand the mobilities of "flap" and "loop" regions of IMPDH-II (1B3O) structures are mostly controlled by the four (W 1, W 2, W 3, and W 4) conserved water molecular centers and their dynamics
20061166 In this small sample of pediatric heart transplant patients receiving MMF, ABCC2, IMPDH1 and IMPDH2 SNPs were associated with MMF GI intolerance and bone marrow toxicity.
20061166 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20045992 Observational study of genotype prevalence. (HuGE Navigator)
19810816 IMPDH2 genetic polymorphism was investigated in 96 individuals of Caucasian origin.
19810816 Observational study of gene-disease association. (HuGE Navigator)
19770842 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19617864 the IMPDH type II 3757T > C polymorphism is associated with an increased IMPDH activity in MMF-treated renal transplant patients
19617864 Observational study of gene-disease association. (HuGE Navigator)
19597826 The expression of IMPDH2 in tumor tissue was significantly higher in patients with colorectal cancer than that in healthy subjects.
19367581 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18976158 Observational study of genotype prevalence. (HuGE Navigator)
18677108 Analysis of in vivo C-MYC interactions with TS, IMPDH2 and PRPS2 genes confirmed that they are direct C-MYC targets.
18583139 The synthesis and activity of several novel inhibitors of IMPDH2 are reported.
18444945 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18043470 The effect of diabetes mellitus on mycophenolic acid pharmacokinetics and catalytic activity of inosine monophosphate dehydrogenase 2 was investigated in maintenance kidney transplant recipients.
17713475 Mycophenolate mofetil up-regulates IMPDH-I and IMPDH-II mRNA in peripheral blood mononuclear cells. May predict acute rejection.
17660802 IMPDH2 is a marker gene useful for stratifying osteosarcoma patients into low- and high-risk groups and predicting therapy outcome.
17496727 Observational study of genotype prevalence. (HuGE Navigator)
17496727 Nine genetic variants were identified in the IMPDH2 gene, with frequencies of the rarer alleles ranging from 0.5 to 10.2%.
15621150 Pharmacogenetic analysis of IMPDH II may represent a novel approach to mycophenolate mofetil therapeutic monitoring.

AA Sequence

MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITLKTPLVSSPM      1 - 70
DTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFC     71 - 140
GIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLP    141 - 210
IVNEDDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNS    211 - 280
IFQINMIKYIKDKYPNLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKV    281 - 350
SEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAM    351 - 420
DKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKF    421 - 490
EKRTSSAQVEGGVHSLHSYEKRLF                                                  491 - 514
//

Text Mined References (66)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25465060 2015 Elevated expression of IMPDH2 is associated with progression of kidney and bladder cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25392102 2014 IMPDH2 mediate radioresistance and chemoresistance in osteosarcoma cells.
25105143 2014 Expression of IMPDH mRNA after mycophenolate administration in male volunteers.
24980853 2014 Ultrastructure of cytoplasmic and nuclear inosine-5'-monophosphate dehydrogenase 2 "rods and rings" inclusions.
24659377 2014 Enhanced expression of IMPDH2 promotes metastasis and advanced tumor progression in patients with prostate cancer.
24477477 2014 Glutamine deprivation initiates reversible assembly of mammalian rods and rings.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22928911 2013 An insight to the dynamics of conserved water-mediated salt bridge interaction and interdomain recognition in hIMPDH isoforms.
22066532 2011 Role of salt bridge dynamics in inter domain recognition of human IMPDH isoforms: an insight to inhibitor topology for isoform-II.
22029192 2011 Autoantibodies against inosine-5'-monophosphate dehydrogenase 2--characteristics and prevalence in patients with HCV-infection.
21996196 2011 Lymphocyte counts in kidney allograft recipients are associated with IMPDH2 3757T>C gene polymorphism.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
21460227 2011 IMPDHII protein inhibits Toll-like receptor 2-mediated activation of NF-kappaB.
21269460 2011 Initial characterization of the human central proteome.
21181270 2011 Inter-ethnic variability of three functional polymorphisms affecting the IMPDH2 gene.
20808934 2010 Overexpression of inosine 5'-monophosphate dehydrogenase type II mediates chemoresistance to human osteosarcoma cells.
20718729 2010 Pharmacogenetics of the mycophenolic acid targets inosine monophosphate dehydrogenases IMPDH1 and IMPDH2: gene sequence variation and functional genomics.
20679962 2010 Polymorphisms in type I and II inosine monophosphate dehydrogenase genes and association with clinical outcome in patients on mycophenolate mofetil.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20135634 Conserved water mediated recognition and the dynamics of active site Cys 331 and Tyr 411 in hydrated structure of human IMPDH-II.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20061166 2010 Genetic polymorphisms influence mycophenolate mofetil-related adverse events in pediatric heart transplant patients.
20045992 2009 Genetic variations in the HGPRT, ITPA, IMPDH1, IMPDH2, and GMPS genes in Japanese individuals.
19946888 2010 Defining the membrane proteome of NK cells.
19810816 2009 IMPDH2 genetic polymorphism: a promoter single-nucleotide polymorphism disrupts a cyclic adenosine monophosphate responsive element.
19770842 2010 An inosine 5'-monophosphate dehydrogenase 2 single-nucleotide polymorphism impairs the effect of mycophenolic acid.
19617864 2009 Interpatient variability in IMPDH activity in MMF-treated renal transplant patients is correlated with IMPDH type II 3757T > C polymorphism.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19597826 2009 Identification of IMPDH2 as a tumor-associated antigen in colorectal cancer using immunoproteomics analysis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19367581 2010 Identification of neuroglycan C and interacting partners as potential susceptibility genes for schizophrenia in a Southern Chinese population.
18976158 2008 Interpopulation variation frequency of human inosine 5'-monophosphate dehydrogenase type II (IMPDH2) genetic polymorphisms.
18677108 2008 Direct role of nucleotide metabolism in C-MYC-dependent proliferation of melanoma cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18583139 2008 Bis(sulfonamide) isosters of mycophenolic adenine dinucleotide analogues: inhibition of inosine monophosphate dehydrogenase.
18444945 2008 Association of four DNA polymorphisms with acute rejection after kidney transplantation.
18043470 2007 Effect of diabetes mellitus on mycophenolate sodium pharmacokinetics and inosine monophosphate dehydrogenase activity in stable kidney transplant recipients.
17713475 2008 Expression of inosine monophosphate dehydrogenase type I and type II after mycophenolate mofetil treatment: a 2-year follow-up in kidney transplantation.
17660802 2007 Prognostic significance of drug-regulated genes in high-grade osteosarcoma.
17496727 2007 A novel variant L263F in human inosine 5'-monophosphate dehydrogenase 2 is associated with diminished enzyme activity.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15670151 2005 Modulation of IMPDH2, survivin, topoisomerase I and vimentin increases sensitivity to methotrexate in HT29 human colon cancer cells.
15621150 2004 An exploratory study on pharmacogenetics of inosine-monophosphate dehydrogenase II in peripheral mononuclear cells from liver-transplant recipients.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14766016 2004 Inosine 5'-monophosphate dehydrogenase binds nucleic acids in vitro and in vivo.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
10930578 2000 PKB/Akt interacts with inosine-5' monophosphate dehydrogenase through its pleckstrin homology domain.
10194364 1999 Acid-base catalysis in the chemical mechanism of inosine monophosphate dehydrogenase.
10097070 1999 Crystal structure of human type II inosine monophosphate dehydrogenase: implications for ligand binding and drug design.
9858805 1998 Assignment1 of inosine '-monophosphate dehydrogenase type 2 (IMPDH2) to human chromosome band 3p21.2 by in situ hybridization.
9278455 1997 Regulation of inosine-5'-monophosphate dehydrogenase type II gene expression in human T cells. Role for a novel 5' palindromic octamer sequence.
8098009 1993 Chromosomal localization and structure of the human type II IMP dehydrogenase gene (IMPDH2).
7999076 1994 Cloning and sequence of the human type II IMP dehydrogenase gene.
7910933 1994 Tissue-differential expression of two distinct genes for human IMP dehydrogenase (E.C.1.1.1.205).
7903306 1993 Characterization of human type I and type II IMP dehydrogenases.
7896827 1995 Characterization of the human inosine-5'-monophosphate dehydrogenase type II gene.
7763314 1995 Recombinant human inosine monophosphate dehydrogenase type I and type II proteins. Purification and characterization of inhibitor binding.
2902093 1988 Cloning and sequence analysis of the human and Chinese hamster inosine-5'-monophosphate dehydrogenase cDNAs.
1969416 1990 Two distinct cDNAs for human IMP dehydrogenase.
1574589 1992 De novo purine nucleotide biosynthesis.