Property Summary

Ligand Count 477
NCBI Gene PubMed Count 62
PubMed Score 94.34
PubTator Score 83.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute quadriplegic myopathy 1.349 1.0e-07
astrocytoma 1.100 6.4e-17
atypical teratoid / rhabdoid tumor 1.100 3.3e-04
colon cancer 1.200 3.1e-02
cutaneous lupus erythematosus -1.200 1.5e-02
diabetes mellitus -1.300 3.8e-03
group 3 medulloblastoma 1.600 5.8e-05
intraductal papillary-mucinous neoplasm ... -1.900 1.6e-04
lung cancer 2.500 2.1e-03
medulloblastoma, large-cell 1.900 1.1e-05
Multiple myeloma 2.273 1.0e-03
oligodendroglioma 1.200 2.0e-12
ovarian cancer -1.600 6.3e-04
pancreatic cancer -1.200 2.8e-04
posterior fossa group A ependymoma 1.100 9.6e-08
primary pancreatic ductal adenocarcinoma -1.335 2.0e-04
psoriasis 1.300 3.8e-04
Waldenstrons macroglobulinemia 1.920 6.6e-04

Protein-protein Interaction (4)

Gene RIF (42)

AA Sequence

MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKITLKTPLVSSPM      1 - 70
DTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVVLSPKDRVRDVFEAKARHGFC     71 - 140
GIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLP    141 - 210
IVNEDDELVAIIARTDLKKNRDYPLASKDAKKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNS    211 - 280
IFQINMIKYIKDKYPNLQVIGGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKV    281 - 350
SEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAM    351 - 420
DKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKF    421 - 490
EKRTSSAQVEGGVHSLHSYEKRLF                                                  491 - 514
//

Text Mined References (72)

PMID Year Title