Property Summary

NCBI Gene PubMed Count 29
PubMed Score 195.68
PubTator Score 159.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.176 1.5e-02
hereditary spastic paraplegia -1.293 9.7e-04
intraductal papillary-mucinous neoplasm ... 1.900 8.7e-03
ovarian cancer -2.000 5.4e-07

Protein-protein Interaction (3)

Gene RIF (4)

PMID Text
23027737 Comparison of MmIMPase 1 and HsIMPase 1 revealed a core r.m.s. deviation of 0.516 A
20153384 The current study did not support a substantial role of the upregulation of IMPase in bipolar disorder, although the lithium-insensitivity trait seen in IMPA2 transgenic mice might represent some aspect relevant to the inositol depletion hypothesis.
17068342 IMPA2 has a separate function in vivo from that of IMPA1
14699425 No association between polymorphisms and bipolar disorder

AA Sequence

MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGE      1 - 70
ESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAF     71 - 140
CNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADA    141 - 210
YYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED       211 - 277
//

Text Mined References (35)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23535730 2013 GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23027737 2012 Cloning, expression, purification, crystallization and X-ray analysis of inositol monophosphatase from Mus musculus and Homo sapiens.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20153384 2010 Behavioral analyses of transgenic mice harboring bipolar disorder candidate genes, IMPA1 and IMPA2.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17068342 2007 Spatial expression patterns and biochemical properties distinguish a second myo-inositol monophosphatase IMPA2 from IMPA1.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14699425 2004 Examination of IMPA1 and IMPA2 genes in manic-depressive patients: association between IMPA2 promoter polymorphisms and bipolar disorder.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12176979 2002 Myo-inositol monophosphatase is an activated target of calbindin D28k.
11959401 Inositol monophosphatase activity in normal, Down syndrome and dementia of the Alzheimer type CSF.
11911470 2002 Production of monoclonal antibodies and immunohistochemical studies of brain myo-inositol monophosphate phosphatase.
11281967 1999 Effect of bipolar disorder on lymphocyte inositol monophosphatase mRNA levels.
9462881 1997 Brain inositol monophosphatase identified as a galactose 1-phosphatase.
9339367 1997 Genomic structure and chromosomal localization of a human myo-inositol monophosphatase gene (IMPA).
9210592 1997 Molecular characterization of coding and untranslated regions of rat cortex lithium-sensitive myo-inositol monophosphatase cDNA.
8718889 1996 The contribution of lysine-36 to catalysis by human myo-inositol monophosphatase.
8068621 1994 Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis.
8068620 1994 Structural analysis of inositol monophosphatase complexes with substrates.
6253491 1980 The effects of lithium ion and other agents on the activity of myo-inositol-1-phosphatase from bovine brain.
1377913 1992 cDNA cloning of human and rat brain myo-inositol monophosphatase. Expression and characterization of the human recombinant enzyme.
1332026 1992 Structure of inositol monophosphatase, the putative target of lithium therapy.