Property Summary

Ligand Count 3
NCBI Gene PubMed Count 30
PubMed Score 211.72
PubTator Score 159.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
hereditary spastic paraplegia -1.293 9.7e-04
intraductal papillary-mucinous neoplasm ... 1.900 8.7e-03
Multiple myeloma 1.176 1.5e-02
ovarian cancer -2.000 5.4e-07

Gene RIF (5)

AA Sequence

MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGE      1 - 70
ESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAF     71 - 140
CNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADA    141 - 210
YYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED       211 - 277
//

Text Mined References (36)

PMID Year Title