Property Summary

NCBI Gene PubMed Count 55
PubMed Score 1.83
PubTator Score 123.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Rheumatoid Arthritis 1170 3.0e-03

Expression

  Differential Expression (1)

Disease log2 FC p
Rheumatoid Arthritis -1.400 3.0e-03

 GO Process (1)

Gene RIF (32)

PMID Text
26837693 IMP3 represents a biomarker of unfavorable prognosis for clear cell carcinomas of the ovary, even in stage I patients.
26826410 Describe chromosome 12p abnormalities and IMP3 expression in prepubertal pure testicular teratomas.
26617820 IMP3 expression in biopsy specimens could be used to predict lymph node metastasis and TNM stage in colorectal cancer patients
26403409 IMP-3 expression is not a useful discriminator between dysplastic nevi and melanoma nor a good prognostic marker in melanoma.
26353850 This is the first study evaluating the IMP3 immunohistochemical expression in Phyllodes tumor. Its expression correlates with histological grade and could be used in the differential diagnosis of fibroepithelial tumors and in prognostication.
26158423 Testing for a combination of elevated IMP3 and Lin28B levels could further facilitate the identification of a patient subgroup with the worst prognosis.
25982283 we show that SOX2 is a transcriptional target of SLUG. These data establish a novel mechanism of breast tumor initiation involving IMP3 and they provide a rationale for its association with aggressive disease and poor outcome.
25919292 IMP3 promotes renal cell carcinoma cell migration and invasion by activation of NF-small ka, CyrillicB pathway.
25886367 These results suggest that IMP3 facilitates PDAC progression by enhancing the pro-metastatic behaviour of tumour cells.
25740666 Positive expression of IMP3 in spinal giant cell tumor was associated with increased microvessel density and expression of IGF2.
25695077 The role of IMP3 as a marker of poor outcome.
25521223 This study demonstrated that Genes overexpressed in Pilomyxoid Astrocytoma vs. Pilocytic Astrocytoma, ranked according to fold-change, included developmental genes H19, DACT2,COL2A1; COL1A1 and IMP3.
25389240 It was concluded that IMP3 and nucleophosmin cannot be a routine diagnostic marker for discrimination of papillary carcinomas and benign lesions. IMP3 positive staining was scarce in IMP3 positive papillary carcinomas although specifity of IMP3 is 100%
25380351 IMP-3 has a role in promoting migration and invasion of melanoma cells by modulating the expression of HMGA2 and predicts poor prognosis in melanoma
25376377 The specificity for IMP3, GLUT-1, and EMA for differentiating malignant mesotheliomas and benign mesothelial proliferations was 100%
25337222 CK5/6, IMP3 and TTF1 immunostaining appears to be useful to improve the accuracy of cytological diagnoses between reactive mesothelial cells, metastatic adenocarcinoma of lung and non-lung origin in pleural effusion.
25183049 These results suggested that pancreatic carcinogenesis involves an increased IMP3 mRNA expression, and it may become valuable diagnostic and prognostic markers as well as potential therapeutic targets for pancreatic cancer.
25141312 IMP3 expression was positive in esophageal adenocarcinoma and Barrett's esophagus with high-grade dysplasia. Barrett's esophagus and esophageal squamous epithelium had no IMP3 expression.
25038792 IMP3 may be involved in the process and progression of high-grade serous carcinoma of the fallopian tube.
25031719 Our results strengthen the association of IMP3 with the regulation of epithelial to mesenchymal transition in breast cancers
25014991 tubal secretory cells with IMP3 signatures showing growth advantage could potentially serve as a latent precancer biomarker for tubal or pelvic serous carcinomas in women.
24966917 High-grade dysplasia and gastric carcinomas can be distinguished from low-grade dysplasia and inflammatory lesions of the gastric mucosa with a high specificity and good sensitivity using a combination of the immunohistochemical markers IMP3 and p53.
24726263 Absence of IMP3 expression is associated with a significantly reduced risk of lymphovascular invasion in pT1 esophageal adenocarcinoma
24713990 This review focuses on the studies of IMP3 expression in different cancers and emphasizes the potential utility of IMP3 in routine surgical pathology practice.
24703842 IMP3 upregulates HMGA2 mRNA by opposing its interaction with Ago2/let-7.
24647926 High IMP3 expression is associated with hepatocellular carcinoma.
24615121 High IMP3 was associated with metastasis in prostate cancer.
24605891 High expression of IMP3 in adult mature testicular teratomas supports their malignant nature.
24457229 Diffuse IMP3 expression (>25%) in MAC from patients with gastric adenocarcinoma was associated with shorter survival.
24135846 The results of this study indicate that IMP3 was overexpressed in sacral chordoma and this expression was associated with tumor invasion and recurrence.
23923073 the combination of p16/IMP3 expression was found to improve the discrepant results between cervical cytologic and histologic diagnoses
23812426 Post-transcriptional regulation of cyclins D1, D3 and G1 and proliferation of human cancer cells depend on IMP-3 nuclear localization.

AA Sequence

MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQ      1 - 70
FRVRASAALLDKLYALGLVPTRGSLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGP     71 - 140
DVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLEA                              141 - 184
//

Text Mined References (56)

PMID Year Title
26837693 2016 Clear cell carcinomas of the ovary: a mono-institutional study of 73 cases in China with an analysis of the prognostic significance of clinicopathological parameters and IMP3 expression.
26826410 2016 Chromosome 12p abnormalities and IMP3 expression in prepubertal pure testicular teratomas.
26617820 2015 IMP3 expression in biopsy specimens of colorectal cancer predicts lymph node metastasis and TNM stage.
26403409 IMP-3 EXPRESSION IN BENIGN MELANOCYTIC NEVI, DYSPLASTIC NEVI AND MALIGNANT MELANOMA: PRELIMINARY FINDINGS IN BULGARIAN PATIENTS.
26353850 2016 IMP3 Is Strongly Expressed in Malignant Phyllodes Tumors of the Breast: An Immunohistochemical Study.
26158423 2015 Overexpression of the RNA-binding proteins Lin28B and IGF2BP3 (IMP3) is associated with chemoresistance and poor disease outcome in ovarian cancer.
25982283 2016 IMP3 promotes stem-like properties in triple-negative breast cancer by regulating SLUG.
25919292 2015 Enhanced IMP3 Expression Activates NF-?B Pathway and Promotes Renal Cell Carcinoma Progression.
25886367 2015 The involvement of insulin-like growth factor 2 binding protein 3 (IMP3) in pancreatic cancer cell migration, invasion, and adhesion.
25740666 2015 Expression of IMP3 and IGF2 in giant cell tumor of spine is associated with tumor recurrence and angiogenesis.
25695077 2015 The oncofetal protein IMP3: a novel grading tool and predictor of poor clinical outcome in human gliomas.
25521223 2015 Pilomyxoid Astrocytoma (PMA) Shows Significant Differences in Gene Expression vs. Pilocytic Astrocytoma (PA) and Variable Tendency Toward Maturation to PA.
25416956 2014 A proteome-scale map of the human interactome network.
25389240 2015 Significance of IMP3, nucleophosmin, and Ki-67 expression in papillary thyroid carcinoma.
25380351 2015 IMP-3 promotes migration and invasion of melanoma cells by modulating the expression of HMGA2 and predicts poor prognosis in melanoma.
25376377 2014 Practical utility of insulin-like growth factor II mRNA-binding protein 3, glucose transporter 1, and epithelial membrane antigen for distinguishing malignant mesotheliomas from benign mesothelial proliferations.
25337222 2014 A fine decision tree consisted of CK5/6, IMP3 and TTF1 for cytological diagnosis among reactive mesothelial cells, metastatic adenocarcinoma of lung and non-lung origin in pleural effusion.
25183049 2015 Expression and clinical significance of IMP3 in microdissected premalignant and malignant pancreatic lesions.
25141312 2014 Usefulness of insulin-like growth factor II mRNA-binding protein 3 (IMP3) as a new marker for the diagnosis of esophageal adenocarcinoma in challenging cases.
25038792 2014 IMP3 as a cytoplasmic biomarker for early serous tubal carcinogenesis.
25031719 2014 IMP3 expression is associated with epithelial-mesenchymal transition in breast cancer.
25014991 2014 IMP3 signatures of fallopian tube: a risk for pelvic serous cancers.
24966917 2014 Immunohistochemical expression of IMP3 and p53 in inflammatory lesions and neoplastic lesions of the gastric mucosa.
24726263 2014 Role of lymphovascular invasion and immunohistochemical expression of IMP3 in the risk stratification of superficially invasive pT1 esophageal adenocarcinoma.
24713990 2014 Oncofetal protein IMP3, a new cancer biomarker.
24703842 2014 IMP3 RNP safe houses prevent miRNA-directed HMGA2 mRNA decay in cancer and development.
24647926 2014 IMP3 combined with CD44s, a novel predictor for prognosis of patients with hepatocellular carcinoma.
24615121 2014 Prognostic value of tissue and circulating levels of IMP3 in prostate cancer.
24605891 2014 Differential expression of IMP3 between male and female mature teratomas--immunohistochemical evidence of malignant nature.
24457229 2014 Insulin-like growth factor-II mRNA-binding protein 3 expression in effusion cytology: a marker for metastatic adenocarcinoma cells and a potential prognostic indicator in gastric adenocarcinoma.
24135846 2014 Expression of insulin-like growth factor II mRNA-binding protein 3 (IMP3) in sacral chordoma.
23923073 2013 Combined detection of p16(INK4a) and IMP3 increase the concordance rate between cervical cytologic and histologic diagnosis.
23812426 2014 Post-transcriptional regulation of cyclins D1, D3 and G1 and proliferation of human cancer cells depend on IMP-3 nuclear localization.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
19060904 2009 An empirical framework for binary interactome mapping.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15635413 2005 Nucleolar proteome dynamics.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12655004 2003 The human Imp3 and Imp4 proteins form a ternary complex with hMpp10, which only interacts with the U3 snoRNA in 60-80S ribonucleoprotein complexes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11543634 2001 The human mitochondrial ribosomal protein genes: mapping of 54 genes to the chromosomes and implications for human disorders.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8012384 1994 Purification of CpG islands using a methylated DNA binding column.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.