Property Summary

NCBI Gene PubMed Count 68
PubMed Score 1.83
PubTator Score 123.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Rheumatoid arthritis 1191 3.0e-03

Expression

  Differential Expression (1)

Disease log2 FC p
Rheumatoid arthritis -1.400 3.0e-03

 GO Process (1)

Gene RIF (45)

AA Sequence

MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQ      1 - 70
FRVRASAALLDKLYALGLVPTRGSLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGP     71 - 140
DVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLEA                              141 - 184
//

Text Mined References (69)

PMID Year Title