Property Summary

NCBI Gene PubMed Count 20
PubMed Score 14.75
PubTator Score 11.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (4)

Disease log2 FC p
tuberculosis 1.200 1.0e-05
psoriasis -1.300 2.3e-09
Breast cancer -1.300 1.8e-10
acute myeloid leukemia -1.100 6.0e-03

Gene RIF (10)

PMID Text
24549057 genomic rearrangements affecting IMMP2L may be one of the predisposing factors involved in Tourette syndrome and overlapping neurodevelopmental disorders.
22948383 Five genes have been directly disrupted in Tourette Syndrome by independent genomic rearrangements and copy number variations with unique breakpoints.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20398908 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19546859 Observational study of gene-disease association. (HuGE Navigator)
19401682 AUTS1/AUTS5 linkage to immp2l-dock4 may be involved in autism susceptibility
19401682 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAQSQGWVKRYIKAFCKGFFVAVPVAVTFLDRVACVARVEGASMQPSLNPGGSQSSDVVLLNHWKVRNFE      1 - 70
VHRGDIVSLVSPKNPEQKIIKRVIALEGDIVRTIGHKNRYVKVPRGHIWVEGDHHGHSFDSNSFGPVSLG     71 - 140
LLHAHATHILWPPERWQKLESVLPPERLPVQREEE                                       141 - 175
//

Text Mined References (20)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24549057 2014 Intragenic deletions affecting two alternative transcripts of the IMMP2L gene in patients with Tourette syndrome.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
22948383 2012 Pathogenetic model for Tourette syndrome delineates overlap with related neurodevelopmental disorders including Autism.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
19546859 2010 Rare structural variants found in attention-deficit hyperactivity disorder are preferentially associated with neurodevelopmental genes.
19401682 2010 High-density SNP association study and copy number variation analysis of the AUTS1 and AUTS5 loci implicate the IMMP2L-DOCK4 gene region in autism susceptibility.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15814844 2005 Mature DIABLO/Smac is produced by the IMP protease complex on the mitochondrial inner membrane.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11254443 2001 Disruption of a novel gene (IMMP2L) by a breakpoint in 7q31 associated with Tourette syndrome.
9847074 1998 Toward a complete human genome sequence.