Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.11
PubTator Score 3.46

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 2.0e-03
ependymoma 1.200 9.1e-08
glioblastoma 1.300 9.8e-04
group 3 medulloblastoma 1.300 1.1e-03
medulloblastoma, large-cell 1.500 3.2e-04
pediatric high grade glioma 1.300 3.9e-05
primitive neuroectodermal tumor 1.500 1.5e-04

Gene RIF (2)

AA Sequence

MLRGVLGKTFRLVGYTIQYGCIAHCAFEYVGGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVI      1 - 70
AKSPSDPKSNICKRVIGLEGDKILTTSPSDFFKSHSYVPMGHVWLEGDNLQNSTDSRCYGPIPYGLIRGR     71 - 140
IFFKIWPLSDFGFLRASPNGHRFSDD                                                141 - 166
//

Text Mined References (8)

PMID Year Title