Property Summary

NCBI Gene PubMed Count 16
PubMed Score 7.40
PubTator Score 8.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8297 4.2e-06
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.100 4.2e-06

Gene RIF (5)

AA Sequence

MDLFGDLPEPERSPRPAAGKEAQKGPLLFDDLPPASSTDSGSGGPLLFDDLPPASSGDSGSLATSISQMV      1 - 70
KTEGKGAKRKTSEEEKNGSEELVEKKVCKASSVIFGLKGYVAERKGEREEMQDAHVILNDITEECRPPSS     71 - 140
LITRVSYFAVFDGHGGIRASKFAAQNLHQNLIRKFPKGDVISVEKTVKRCLLDTFKHTDEEFLKQASSQK    141 - 210
PAWKDGSTATCVLAVDNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRD    211 - 280
GRVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDEKI    281 - 350
QTREGKSAADARYEAACNRLANKAVQRGSADNVTVMVVRIGH                                351 - 392
//

Text Mined References (23)

PMID Year Title