Property Summary

NCBI Gene PubMed Count 46
PubMed Score 36.43
PubTator Score 31.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.238 1.2e-02
Multiple myeloma 2.563 6.7e-06
glioblastoma 2.000 1.6e-03
group 3 medulloblastoma 2.100 2.7e-05
astrocytoma 1.100 2.4e-02
atypical teratoid/rhabdoid tumor 1.300 2.1e-06
medulloblastoma, large-cell 1.700 4.9e-07
primitive neuroectodermal tumor 1.500 1.1e-05
acute quadriplegic myopathy 1.186 1.9e-06
non-small cell lung cancer 1.030 1.5e-22
lung cancer 1.800 1.6e-05
diabetes mellitus 2.400 1.1e-03
pediatric high grade glioma 1.300 6.6e-06
nasopharyngeal carcinoma 1.100 2.2e-03
lung adenocarcinoma 2.207 2.5e-11
mucosa-associated lymphoid tissue lympho... -1.505 1.5e-02
invasive ductal carcinoma 1.200 1.2e-03
acute myeloid leukemia 5.400 4.8e-02
ovarian cancer 2.500 5.1e-05
Breast cancer 1.400 4.8e-06

 MGI Phenotype (1)

Gene RIF (23)

PMID Text
26891316 Deletion of the RNA binding domains of NF45 and NF90 diminished the enhancement of HIV infection and gene expression.
26381409 The RNA binding complexes NF45-NF90 and NF45-NF110 associate dynamically with the c-fos gene and function as transcriptional coactivators.
26276310 NF45 overexpression is associated with poor prognosis and enhanced cell proliferation of pancreatic ductal adenocarcinoma.
26240280 NF45 and NF90 are novel higher-eukaryote-specific factors required for the maturation of 60S ribosomal subunits.
26059795 Upregulated expression of ILF2 in non-small cell lung cancer is associated with tumor cell proliferation and poor prognosis
25286760 These findings suggested that NF45 might play an important role in promoting the tumorigenesis of ESCC, and thus be a promising therapeutic target to prevent ESCC progression.
25023405 These findings indicate that NF45 plays an important role in the growth regulation of glioma cells
25010285 Tandem affinity purification and mass spectrometry analysis identify interleukin enhancer binding factor 2 (ILF2, NF45), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
24920670 These results suggest a novel molecular mechanism for the modulation of RNA granule assembly and disassembly by NFAR2, NF45, and phosphorylation at double-stranded RNA-activated kinase PKR sites.
23129811 AU-rich 5' UTRs harboring internal ribosome entry sites are regulated by NF45. NF45 regulates XIAP protein levels through interaction with its IRES.
23125841 Tandem affinity purification and mass spectrometry analysis identify interleukin enhancer binding factor 2 (ILF2, NF45), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22174317 Tandem affinity purification and mass spectrometry analysis identify interleukin enhancer binding factor 2 (ILF2, NF45), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21969602 The NF90/NF45 complex participates in DNA break repair via nonhomologous end joining
21823664 spatial interactions of hnRNPH1, NF45, and C14orf166 with HCVc174 likely modulate HCV or cellular functions during acute and chronic HCV infection
20808282 ILF2 recruits a DNA-associated replication and transcription complex, of which it is a part, to its target DNA sequence.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20051514 our results identify NF45 and NF90 as novel regulators of HS4-dependent human IL13 transcription in response to T cell activation
19893574 The data presented are consistent with a model in which translation of cIAP1 is governed, at least in part, by NF45, a novel cellular IRES trans-acting factor.
19454010 Tandem affinity purification and mass spectrometry analysis identify interleukin enhancer binding factor 2 (ILF2, NF45), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
19398578 Results suggest that the association of the NF90-NF45 complex with pri-miRNAs impairs access of the Microprocessor complex to the pri-miRNAs, resulting in a reduction of mature miRNA production.
18458058 Cell growth is retarded and giant multinucleated cells accumulate when the expression of NF45 or NF90, but not NF110, is reduced in HeLa cells.
15817156 NF45 is a is a highly conserved transcriptional activator of the gene IL-2.
11958450 plays important role in protein priming of HBV polymerase

AA Sequence

MRGDRGRGRGGRFGSRGGPGGGFRPFVPHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAE      1 - 70
QASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGN     71 - 140
KVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARW    141 - 210
FEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLF    211 - 280
LPGSVGITDPCESGNFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWDGVI    281 - 350
VTPSEKAYEKPPEKKEGEEEEENTEEPPQGEEEESMETQE                                  351 - 390
//

Text Mined References (54)

PMID Year Title
26891316 2016 NF45 and NF90 Bind HIV-1 RNA and Modulate HIV Gene Expression.
26381409 2015 The RNA binding complexes NF45-NF90 and NF45-NF110 associate dynamically with the c-fos gene and function as transcriptional coactivators.
26276310 2015 NF45 overexpression is associated with poor prognosis and enhanced cell proliferation of pancreatic ductal adenocarcinoma.
26240280 2015 The NF45/NF90 Heterodimer Contributes to the Biogenesis of 60S Ribosomal Subunits and Influences Nucleolar Morphology.
26059795 2015 Upregulated expression of ILF2 in non-small cell lung cancer is associated with tumor cell proliferation and poor prognosis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25286760 2015 Expression and clinical role of NF45 as a novel cell cycle protein in esophageal squamous cell carcinoma (ESCC).
25023405 2014 Expression of NF45 correlates with malignant grade in gliomas and plays a pivotal role in tumor growth.
24920670 2014 RNA granule assembly and disassembly modulated by nuclear factor associated with double-stranded RNA 2 and nuclear factor 45.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23502783 2013 The CCND1 c.870G>A polymorphism is a risk factor for t(11;14)(q13;q32) multiple myeloma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23129811 2013 Nucleotide composition of cellular internal ribosome entry sites defines dependence on NF45 and predicts a posttranscriptional mitotic regulon.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21969602 2011 The NF90/NF45 complex participates in DNA break repair via nonhomologous end joining.
21823664 2011 Identification of hnRNPH1, NF45, and C14orf166 as novel host interacting partners of the mature hepatitis C virus core protein.
21269460 2011 Initial characterization of the human central proteome.
21146485 2011 Identification of cyclophilin-40-interacting proteins reveals potential cellular function of cyclophilin-40.
21123651 2010 Phosphorylation of the NFAR proteins by the dsRNA-dependent protein kinase PKR constitutes a novel mechanism of translational regulation and cellular defense.
20808282 2010 A multiprotein complex necessary for both transcription and DNA replication at the ?-globin locus.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20051514 2010 NF45 and NF90 regulate HS4-dependent interleukin-13 transcription in T cells.
19946888 2010 Defining the membrane proteome of NK cells.
19893574 2010 NF45 functions as an IRES trans-acting factor that is required for translation of cIAP1 during the unfolded protein response.
19398578 2009 The NF90-NF45 complex functions as a negative regulator in the microRNA processing pathway.
18458058 2008 Nuclear factor 45 (NF45) is a regulatory subunit of complexes with NF90/110 involved in mitotic control.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17890166 2007 The nuclear PP1 interacting protein ZAP3 (ZAP) is a putative nucleoside kinase that complexes with SAM68, CIA, NF110/45, and HNRNP-G.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17289661 2007 Molecular composition of IMP1 ribonucleoprotein granules.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16055709 2005 ADAR1 interacts with NF90 through double-stranded RNA and regulates NF90-mediated gene expression independently of RNA editing.
15817156 2005 NF45/ILF2 tissue expression, promoter analysis, and interleukin-2 transactivating function.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14559993 2003 Regulation of alternative splicing by SRrp86 and its interacting proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429849 2002 Functional proteomic analysis of human nucleolus.
11958450 2002 Host cell proteins binding to the encapsidation signal epsilon in hepatitis B virus RNA.
11804788 2002 Ilf2 is regulated during meiosis and associated to transcriptionally active chromatin.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11739746 2002 The RNA binding protein nuclear factor 90 functions as both a positive and negative regulator of gene expression in mammalian cells.
11438540 2001 Nuclear factor 90 is a substrate and regulator of the eukaryotic initiation factor 2 kinase double-stranded RNA-activated protein kinase.
11101529 2000 Functional analysis of the human CDC5L complex and identification of its components by mass spectrometry.
10574923 1999 Autoantibodies define a family of proteins with conserved double-stranded RNA-binding domains as well as DNA binding activity.
10320367 1999 Nuclear factor-90 of activated T-cells: A double-stranded RNA-binding protein and substrate for the double-stranded RNA-dependent protein kinase, PKR.
9442054 1998 DNA-dependent protein kinase interacts with antigen receptor response element binding proteins NF90 and NF45.
8974006 1996 Mapping interleukin enhancer binding factor 2 gene (ILF2) to human chromosome 1 (1q11-qter and 1p11-p12) by polymerase chain reaction amplification of human-rodent somatic cell hybrid DNA templates.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7519613 1994 Cloning and expression of cyclosporin A- and FK506-sensitive nuclear factor of activated T-cells: NF45 and NF90.