Property Summary

NCBI Gene PubMed Count 46
PubMed Score 5.32
PubTator Score 45.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count
Liver diseases 66

Expression

Protein-protein Interaction (11)

Gene RIF (27)

PMID Text
26082242 The findings indicated that IL-9R was constitutively expressed and exerted a tumor-promoting effect in hepatocellular carcinoma, whose expression level may be a useful biomarker of tumor invasiveness and patient clinical outcome.
25421756 Low expression of CD39(+) /CD45RA(+) on regulatory T cells (Treg ) cells in type 1 diabetic children in contrast to high expression of CD101(+) /CD129(+) on Treg cells in children with coeliac disease.
25297818 Confocal microscopy and fluorescence resonance energy transfer experiments revealed nonrandom association of IL-9R with IL-2R/major histocompatibility complex glycoproteins at the surface of human T lymphoma cells.
24908389 Mice with PU.1 deficiency in T cells were protected from colitis, whereas treatment with antibody to IL-9 suppressed colitis
23638223 Our findings suggest that overexpression of IL-9R may contribute to the pathogenesis of diffuse large B-cell lymphoma
22638550 One of the identified peptide sequences corresponded to a fragment of the human interleukin-9 receptor alpha (IL-9Ralpha).
21371865 analysis of IL-9 and IL-9 receptor gene polymorphisms and atopic dermatitis in a Korean population
20673868 Observational study of gene-disease association. (HuGE Navigator)
20595916 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20424473 Observational study of gene-disease association. (HuGE Navigator)
19723899 There is an association of at least 2 X-chromosomal genes with rheumatoid arthritis: TIMP1 and IL9R.
19723899 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19401191 These results reveal a regulatory function for IFN-gamma and IL-10 on modulating the inducible IL-9Ralpha expression levels on peripheral blood neutrophils by T(H)2 cytokines.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19139102 IL-9Ralpha and IL-2Rbeta homodimers efficiently mediate constitutive activation of ALL-associated JAK1 mutants.
18829468 the preformed complexes between gamma c and IL-2Rbeta or IL-9Ralpha promote signaling by the JAK3 A572V mutant without ligand, identified in several human cancers.
18633131 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18339896 primary ATL cells, via IL-9, support the action of IL-9Ralpha/CD14-expressing monocytes, which subsequently support the ex vivo spontaneous proliferation of malignant T cells
17919707 IL-9R alpha was expressed on human tonsillar B cells, with an ability to transduce signals through activation of signal transducer and activator of transcription 3 and 5.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17083349 Variants in the IL4RA gene alone may not exert any major influence on susceptibility to asthma-related diseases in childhood, but in combination with other genes, such as IL9R, IL4RA may be an important gene for disease susceptibility
15621723 IL-9 and its receptor have roles in cell growth and malignant transformation of lymphoid cells associated with constitutive activation of the Jak/STAT pathway [review]
15591265 variations in the IL9R gene may influence susceptibility to childhood wheezing and atopy, and data support the notion that different haplotypes may have sex specific influences
11868823 Human bronchial epithelium expresses interleukin-9 receptors.

AA Sequence

MGLGRCIWEGWTLESEALRRDMGTWLLACICICTCVCLGVSVTGEGQGPRSRTFTCLTNNILRIDCHWSA      1 - 70
PELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYL     71 - 140
PRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILE    141 - 210
AFELDPGFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWPGNTLVAVSIF    211 - 280
LLLTGPTYLLFKLSPRVKRIFYQNVPSPAMFFQPLYSVHNGNFQTWMGAHGAGVLLSQDCAGTPQGALEP    281 - 350
CVQEATALLTCGPARPWKSVALEEEQEGPGTRLPGNLSSEDVLPAGCTEWRVQTLAYLPQEDWAPTSLTR    351 - 420
PAPPDSEGSRSSSSSSSSNNNNYCALGCYGGWHLSALPGNTQSSGPIPALACGLSCDHQGLETQQGVAWV    421 - 490
LAGHCQRPGLHEDLQGMLLPSVLSKARSWTF                                           491 - 521
//

Text Mined References (47)

PMID Year Title
26082242 2015 High expression of IL-9R promotes the progression of human hepatocellular carcinoma and indicates a poor clinical outcome.
25421756 2015 Low expression of CD39(+) /CD45RA(+) on regulatory T cells (Treg ) cells in type 1 diabetic children in contrast to high expression of CD101(+) /CD129(+) on Treg cells in children with coeliac disease.
25297818 2014 Distinct spatial relationship of the interleukin-9 receptor with interleukin-2 receptor and major histocompatibility complex glycoproteins in human T lymphoma cells.
24908389 2014 TH9 cells that express the transcription factor PU.1 drive T cell-mediated colitis via IL-9 receptor signaling in intestinal epithelial cells.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23638223 2013 Overexpression of IL-9 receptor in diffuse large B-cell lymphoma.
22638550 2012 A naturally processed HLA-DR-bound peptide from the IL-9 receptor alpha of HTLV-1-transformed T cells serves as a T helper epitope.
21371865 2011 An association between IL-9 and IL-9 receptor gene polymorphisms and atopic dermatitis in a Korean population.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20595916 2010 Association between IL-1A single nucleotide polymorphisms and chronic beryllium disease and beryllium sensitization.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
19723899 2009 Association of the X-chromosomal genes TIMP1 and IL9R with rheumatoid arthritis.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19401191 2009 T(H)2 cytokines modulate the IL-9R expression on human neutrophils.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19139102 2009 Acute lymphoblastic leukemia-associated JAK1 mutants activate the Janus kinase/STAT pathway via interleukin-9 receptor alpha homodimers.
18829468 2008 Ligand-independent homomeric and heteromeric complexes between interleukin-2 or -9 receptor subunits and the gamma chain.
18633131 2008 Host immune gene polymorphisms in combination with clinical and demographic factors predict late survival in diffuse large B-cell lymphoma patients in the pre-rituximab era.
18339896 2008 Induction of the IL-9 gene by HTLV-I Tax stimulates the spontaneous proliferation of primary adult T-cell leukemia cells by a paracrine mechanism.
17919707 2007 Expression of IL-9 receptor alpha chain on human germinal center B cells modulates IgE secretion.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
17083349 2006 Interaction between variants in the interleukin-4 receptor alpha and interleukin-9 receptor genes in childhood wheezing: evidence from a birth cohort study.
15772651 2005 The DNA sequence of the human X chromosome.
15621723 2004 IL-9 and its receptor: from signal transduction to tumorigenesis.
15591265 2004 Sex specific protective effects of interleukin-9 receptor haplotypes on childhood wheezing and sensitisation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11868823 2002 Human bronchial epithelium expresses interleukin-9 receptors and releases neutrophil chemotactic factor.
11588013 2001 Il-9 stimulates release of chemotactic factors from human bronchial epithelial cells.
11418623 2001 Cutting edge: the common gamma-chain is an indispensable subunit of the IL-21 receptor complex.
11160343 2001 Functional expression of IL-9 receptor by human neutrophils from asthmatic donors: role in IL-8 release.
11039580 2000 The IL9R region contribution in asthma is supported by genetic association in an isolated population.
10657622 2000 Signals from the IL-9 receptor are critical for the early stages of human intrathymic T cell development.
10655549 2000 Differentially regulated and evolved genes in the fully sequenced Xq/Yq pseudoautosomal region.
10642536 2000 14-3-3zeta interacts with the alpha-chain of human interleukin 9 receptor.
10486269 1999 Tip60 interacts with human interleukin-9 receptor alpha-chain.
10329852 1999 IL-9 pathway in asthma: new therapeutic targets for allergic inflammatory disorders.
9535918 1998 Heteromerization of the gammac chain with the interleukin-9 receptor alpha subunit leads to STAT activation and prevention of apoptosis.
9002663 1997 The IL-9 receptor gene, located in the Xq/Yq pseudoautosomal region, has an autosomal origin, escapes X inactivation and is expressed from the Y.
8756628 1996 A single tyrosine of the interleukin-9 (IL-9) receptor is required for STAT activation, antiapoptotic activity, and growth regulation by IL-9.
8666384 1995 The IL-9 receptor gene (IL9R): genomic structure, chromosomal localization in the pseudoautosomal region of the long arm of the sex chromosomes, and identification of IL9R pseudogenes at 9qter, 10pter, 16pter, and 18pter.
8193355 1994 Isolation and characterization of the human interleukin-9 receptor gene.
7718508 1995 Sharing of the IL-2 receptor gamma chain with the functional IL-9 receptor complex.
1376929 1992 Expression cloning of the murine and human interleukin 9 receptor cDNAs.