Property Summary

NCBI Gene PubMed Count 124
PubMed Score 334.36
PubTator Score 870.99

Knowledge Summary

Patent

No data available

Gene RIF (108)

AA Sequence

MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFS      1 - 70
ERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGM     71 - 140
RGKI                                                                      141 - 144
//

Text Mined References (124)

PMID Year Title