Property Summary

NCBI Gene PubMed Count 201
PubMed Score 1163.19
PubTator Score 875.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
glioblastoma 1.200 8.4e-03
intraductal papillary-mucinous adenoma (... 1.600 3.6e-03
intraductal papillary-mucinous neoplasm ... 1.800 5.9e-03
colon cancer -1.600 7.9e-03
lung cancer -2.700 1.4e-05
active Crohn's disease 1.759 3.5e-03
sarcoidosis 1.400 1.2e-02
pancreatic cancer 1.200 1.8e-03
adult high grade glioma 1.300 1.7e-04
pilocytic astrocytoma 1.100 6.9e-05
Breast cancer -1.300 2.4e-02
lung carcinoma -1.600 4.1e-27

Protein-protein Interaction (11)

Gene RIF (185)

PMID Text
26615570 Observed highly significant reductions in the concentration of circulating interleukin (IL)-16, IL-7, and Vascular Endothelial Growth Factor A (VEGF-A) in encephalomyelitis/chronic fatigue syndrome patients.
26479922 IL7 was expressed primarily in the infundibulum and suprabulb of the hair follicle. IL7 expression was increased in cutaneous T-cell lymphoma.
26324773 this study identified that IL-7, as well as the Akt/ mTOR signaling pathway, effectively modulates human Double-Negative T Cell- mediated suppression of allogeneic T cell responses.
26272555 provides negative feedback on its own signaling in T cells via endocytosis and degradation of its receptor, CD127
26177551 IL-7 and SCF are elevated for a prolonged period after double umbilical cord blood transplantation and persistently high levels of these cytokines may correlate with worse clinical outcomes.
26113403 The observations suggest that IL-7 may play a role in the pathogenesis of Graves' disease and may be associated with its clinical activity.
26085358 Common gamma-chain cytokines IL-2, IL-7, and IL-15 prevent differentiation of naive T cells in vitro and limit activation of primed T cells in the absence of antigenic stimulus, which can contribute to the formation of cytokine imbalance.
25933188 IL-7/IL-17 axis mediates chronic pelvic pain in experimental autoimmune prostatitis and in patients.
25870237 These observations provide evidence of a novel mechanism that enables cells to optimally use IL-7.
25784743 Interferon-alpha inhibits CD4 T cell responses to interleukin-7 and interleukin-2 and selectively interferes with Akt signaling.
25411246 IL-7 elevates miR-124 to decrease the expression of splicing regulator PTB and represses CD95 mRNA splicing.
25411246 IL-7 and CD95 synergistically promote survival and proliferation of HIV-1-latently infected CD4+ T-cells measured by increased levels of integrated HIV-1 DNA, suggesting that HIV-1 IN interacts with IL-7 and CD95 in latently infected CD4+ T-cells
25393692 SF of BC OA displayed significantly higher concentrations for a number of proinflammatory cytokines [CXCL1, eotaxin, interferon (IFN)-gamma, interleukin (IL)-7, IL-8, IL-9, IL-12].
25333710 In view of the important role IL-7 plays in lymphocyte proliferation, homeostasis and survival, down regulation of CD127 by Tat likely plays a central role in immune dysregulation and CD4 T-cell decline
25333710 IL-7 and CD95 synergistically promote survival and proliferation of HIV-1-latently infected CD4+ T-cells measured by increased levels of integrated HIV-1 DNA, suggesting that HIV-1 IN interacts with IL-7 and CD95 in latently infected CD4+ T-cells
25263171 The present data indicate that high plasma levels of IL-7 in the early post-transplant period are predictive for slow T cell reconstitution, increased risk of acute graft-versus-host disease and increased mortality following haematopoietic stem cell transplantation.
25184791 blocking IL-7 in hMSCs-lymphocytes co-cultures increased lymphocytes apoptosis and we also have demonstrated that hMSCs are able to produce this interleukin
25169828 Septic patients showed the lowest levels of IL-7. Patients with severe sepsis reached levels of IL-7 higher than those observed in the groups of uncomplicated sepsis and septic shock.
25063872 These data suggest that increased IFN-alpha activity may promote the loss of T cells by accelerating cell turnover and activation-induced cell death while decreasing the renewal of T cells by inhibiting the proliferative effect of IL-7.
25033393 IL-7 and CD95 synergistically promote survival and proliferation of HIV-1-latently infected CD4+ T-cells measured by increased levels of integrated HIV-1 DNA, suggesting that HIV-1 IN interacts with IL-7 and CD95 in latently infected CD4+ T-cells
24999042 IL-7 and CD95 synergistically promote survival and proliferation of HIV-1-latently infected CD4+ T-cells measured by increased levels of integrated HIV-1 DNA, suggesting that HIV-1 IN interacts with IL-7 and CD95 in latently infected CD4+ T-cells
24820104 Low-level transient antigenic stimuli during cART were not associated with changes in the thymic function or the IL-7/CD127 system.
24750122 decreased IL-7 in peripheral blood, maybe, is a consequence of the negative feedback of the pro-inflammatory function in ITP patients.
24695377 These results strongly suggest that IL-7/IL-7R prevents apoptosis by upregulating the expression of bcl-2 and by downregulating the expression of bax
24585897 Diminished T-cell responsiveness to IL-7.
24224652 IL-23 does not induce IL-7 expression in microglia and astrocytes.
24097874 IL-7 can have a significant impact in sustaining expansion and persistence of adoptively chimeric antigen receptor-redirected cytotoxic T lymphocytes.
24049167 IL-7 and CD95 synergistically promote survival and proliferation of HIV-1-latently infected CD4+ T-cells measured by increased levels of integrated HIV-1 DNA, suggesting that HIV-1 IN interacts with IL-7 and CD95 in latently infected CD4+ T-cells
23966629 our data show that IL-7 negatively regulates Tregs
23963040 our data point toward an unexpected new role for IL-7 as a potential autocrine mediator of lymphatic drainage
23628622 Data indicate that both CgammaCR-CD127(+)composed of Interleukin-7 (IL-7) tethered to IL-7Ralpha/CD127, and CgammaCR-CD122(+) CD8(+) T((E/CM)) engraft in mice and persist in an absence of exogenous cytokine administration.
23554911 KGF could up-regulate IL-7 expression through the STAT1/IRF-1, IRF-2 signaling pathway, which is a new insight in potential effects of KGF on the intestinal mucosal immune system.
23454917 These results suggest that ineffective responses to IL-7 could impair the transition to memory cells of naive CD4(+) T lymphocytes recognizing self-peptides in the setting of strong costimulation.
23454692 genetic, immunologic, and metabolic factors contribute to a dysregulation of the IL-7/IL-7 receptor pathway in type 1 diabetes and identify a novel hyperglycemia-mediated interference of immune regulatory networks.
23437070 IL-7 and IL-15 levels remain relatively low after nonmyeloablative transplantation.
23325887 IL-7 or IL-15 priming of the RasGRP/SOS pathway contributes to the increased ERK responsiveness and reduces the threshold above which signaling cascades are initiated, thereby predisposing for autoimmunity.
23244154 Increase in the level of IL-7 is associated with skin pathogenesis in breast cancer.
23188693 Changes of IL-7 expression in different phases of Graves ophthalmopathy (GO) suggested that IL-7 may play an important role in the pathogenesis of GO.
23160470 IL-7 and IL-15 instruct the generation of human memory stem T cells from naive precursors.
23157741 IL-7/IL-7R promotes c-Fos/c-Jun expression and activity in non-small cell lung cancer which further facilitates cyclin D1 expression, and accelerates proliferation of cells and VEGF-D-induced lymphovascular formation.
23129754 IL-7-rich environment abrogates regulatory T (Treg) cell suppressor function and promotes activation and expansion of T effector cells, alloreactive and autoreactive T cells, and Tregs, all of which become fully functional cell populations.
23053510 the first report of rhIL-7 ability to restore normal lymphocyte functions in septic patients.
23018454 Hepatocyte-derived transgenic IL-7 plays an indispensable role in maintenance of natural killer T (NKT) and T cells in adult mouse liver and development of B cells in fetal liver.
22955921 Data show that lymphatic endothelial cells (LECs) are a prominent source of IL-7 both in human and murine lymph nodes.
22949940 Keratinocyte growth factor up-regulates Interleukin-7 expression following intestinal ischemia/reperfusion in vitro and in vivo.
22921903 In conclusion the positive correlation between plasma concentration of IL-7, MCP-1 and hs-CRP in diabetic foot patients observed herein, suggests a plausible role for IL-7 in the promotion of clinical instability in coronary artery disease
22911005 IL-7 and CD95 synergistically promote survival and proliferation of HIV-1-latently infected CD4+ T-cells measured by increased levels of integrated HIV-1 DNA, suggesting that HIV-1 IN interacts with IL-7 and CD95 in latently infected CD4+ T-cells
22897934 The importance of optimal IL-7 and pre-TCR signaling during adult human T cell development, was investigated.
22859301 analysis of synergistic effects of interleukin-7 and pre-T cell receptor signaling in human T cell development
22795293 Data indicate that serum IL-7 was confirmed as independent variable associated to both disease-free survival (DFS) and overall survival (OS).
22618230 these findings demonstrate that IL-7delta5 variant induces human breast cancer cell proliferation and cell cycle progression via activation of PI3K/Akt pathway.
22506826 In our pilot study, we discovered significant changes in methylation patterns of genes IL-7, IL-13, IL-17C and TYK2 between henodialysis patients and healthy subjects
22398700 We did not observe differences in thymic function, but we found that plasma levels of interleukin-7 and the frequency of its receptor were significantly decreased in preterm infants
22384197 JunD/AP-1-mediated gene expression promotes lymphocyte growth dependent on interleukin-7 signal transduction
22314878 IL-7 levels were significantly lower in patients with Crohn's disease than in controls.
22312161 Considering the immunostimulatory ability of IL-7Ralpha T cells and IL-7, this suggests that IL-7(R)-dependent T cell-driven immune activation plays an important role in inflammation in Sjogren syndrome.
22247488 IL-7 was significantly increased in the serum of patients with active Vogt Koyanagi-Harada disease compared with those without or with inactive Vogt Koyanagi-Harada disease.
22194871 High IL-7 concentration can prime resting B cells to CD95-mediated apoptosis via an indirect mechanism.
22113713 IL-7 and TGFbeta1 are promising markers to indicate those at risk for poor prostate cancer survival.
22027639 After seven years of effective highly active antiretroviral therapy, the quantity and capacity of T cell subsets and IL-7 in HIV-1-infected patients had been partially restored.
21920046 HIV infection of thymocytes inhibits IL-7 activity.
21912394 myelodysplastic syndromes patients with normal plasma levels of CXCL10, IL-7 and IL-6 lived significantly longer (median survival 76 months) than those with elevated levels.
21876448 In HIV patients with low or moderate degree of immunodeficiency, CD4 counts and plasma IL-7 levels do not evolve in parallel, suggesting that other factors different from CD4 counts must be involved in the upregulation of IL-7 observed in HIV infection.
21795588 a serum profile of high IL-7 may signify a T(H)1-driven form of MS
21753149 IL-7 dysregulation and loss of CD8+ T cell homeostasis in the monogenic human disease autoimmune polyendocrinopathy-candidiasis-ectodermal dystrophy.
21711552 IL-7 gene expression was similar in controls and bacteraemia, but lower in sepsis patients.
21680796 relationship between CD127 expression, IL-7 signaling and Ig gene rearrangement in pre-B cells
21647866 Expression of IL-7 and its receptor was significantly elevated in rheumatoid arthritis (RA) synovial fluid and peripheral blood macrophages as well as RA fibroblasts, compared to normal cells.
21455214 the existence of a critical crosstalk between PI3K/Akt signaling pathway and ROS that is essential for IL-7-mediated T-ALL cell survival
21418620 The increase of plasma IL-9, and the decrease of plasma IL-5, IL-7 and IFN-gamma may contribute to get further insights into the inflammatory pathways involved in chronic heart failure.
21257970 CD4 T cell subsets from patients with HIV infection show enhanced signal transducer-activator of transcription (STAT)1 phosphorylation in response to exogenous IL-7.
21239710 Increased amounts of bioavailable IL-7 are not detected in the spleens of transgenic IL-7 receptor alpha449F mice because IL-7Ralpha-expressing cells that bind IL-7 are acting as a cytokine sink.
21209878 immunological nonresponders to HIV therapy display elevated BM IL-7/IL-7Ralpha expression but impaired T-cell responsiveness to IL-7, suggesting the activity of a central compensatory pathway targeted to replenish the CD4+ compartment
21159243 The high expression of IL-7 and IL-7R is highly positie correlated with clinic stage, lymph node metastasis, VEGF-D, LVD and poor prognosis in Non-small cell lung cancer.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20815339 A large favorable entropy change, a global favorable electrostatic component, and glycosylation of the receptor, albeit not at the interface, contribute significantly to the interaction between IL-7 and the IL-7R subunit alpha extracellular domain.
20673240 Interleukin-7 enhances memory CD8(+) T-cell recall responses in health but its activity is impaired in human immunodeficiency virus infection.
20660706 IL-7 and CD95 synergistically promote survival and proliferation of HIV-1-latently infected CD4+ T-cells measured by increased levels of integrated HIV-1 DNA, suggesting that HIV-1 IN interacts with IL-7 and CD95 in latently infected CD4+ T-cells
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20546594 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20505146 Transgenic expression of IL-7 restores a protective anti-pneumococcal polysaccharide response in young mice.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20465565 IL-7 protects human CD4+ effector/memory T cells from apoptosis. IL-7 upregulates not only Bcl-2, but also Bcl-xL and Mcl-1. Il-7 activates the JAK/STAT signalling pathway.
20386468 enhances survival of CD56bright NK cells
20382196 Subjects with major depressive disorder had low serum levels of IL7. May underlie the depression-related impairment of T-cell function.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20226540 The IL-7 transcript, lacking exon 4, and not the full length IL-7 represents the dominant IL-7 RNA transcript in human PBMCs and a novel IL-7R splice variant lacking exons 5, 6 and 7.
20200205 IL-7 controls glucose utilization by regulating the gene expression of HXKII, suggesting a mechanism by which IL-7 supports bioenergetics that control cell fate decisions in lymphocytes.
20190194 IL-7 triggers rapid IL-7Ralpha endocytosis, which is required for IL-7-mediated signaling and subsequent receptor degradation
20190192 IL-7 and IL-21 are superior to IL-2 and IL-15 in promoting human T cell-mediated rejection of systemic lymphoma in immunodeficient mice.
20167604 early events leading to IL-7 signal transduction involve its receptor compartmentalization into membrane nanodomains and cytoskeleton recruitment
20131250 IL-7 expression may contribute to the immunopathology of primary Sjogren's syndrome.
20089933 Data demonstrate that IL-7 is a novel myokine regulated both in vitro and in vivo, and it may play a role in the regulation of muscle cell development.
20067635 bone-invading cells express and produce IL-7, which is known to promote osteoclast activation and osteolytic lesions
20035760 Demonstrate that sCD127 is detectable at various levels in the plasma of healthy humans. IL-7 treatment has no impact on sCD127 plasma concentration in patients infected by HIV.
19923894 BMP4 counteracts the IL-7-induced proliferation and differentiation of CD34(+) cells.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19904747 findings suggest that polymorphism of IL-17F 7488 involved in susceptibility to gastric cancer, which also influenced certain subtypes according to clinicopathological features, whereas IL-17A 197 may be less relevant
19889552 Data suggest that an impaired IL-7/JAK3 signal may cause SCID and compromise T-cell differentiation, even if the IL-15 signal is preserved and supports NK-cell development.
19864382 HIV infection perturbs IL-7 responses at both receptor binding and signaling steps, which likely compromises the regenerative capacity of the CD4(+) T-cell pool and may contribute to CD4(+) T-cell depletion
19847194 IL-7 influences neural development at a molecular level by participating in human brain architecture through glia cell formation
19796902 Report a new capillary electrophoresis method that allows quality assessment of purified recombinant Il7, and quantification/profiling of glycoforms of rhIL-7.
19770269 IL-7 and TSLP use different mechanisms to regulate human CD4(+) T cell homeostasis.
19714586 Enhanced expression of IL-7Ralpha and IL-7 in rheumatoid arthritis patients contributes significantly to the joint inflammation by activating T cells, B cells, and macrophages.
19675167 A block in IL-2/IL-7 signaling via the STAT5 pathway provides the basis for low surface expression of the CD8 coreceptor and failure of IL-2 to break CD8 T cell anergy in a transgenic model of spontaneous autoimmunity.
19432535 Responsiveness of T cells to IL-7 is associated with higher CD4+ T cell counts during HAART and thus may be a determinant of the extent of immune reconstitution.
19366834 Lack of epithelial interleukin-7 gene expression in prostate cancer is associated with tumor escape from immunosurveillance.
19299724 IL-7 is essential for human B cell production from adult bone marrow
19279003 These results indicate that adenovirus-REIC has another arm against human cancer, an indirect host-mediated effect because of overproduction of IL-7 by mis-targeted normal human fibroblasts, in addition to its direct effect on cancer cells.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19248116 IL-7 stimulates chondrocyte secretion of S100A4 via activation of JAK/STAT signaling, and then S100A4 acts in an autocrine manner to stimulate MMP-13 production via RAGE.
19240061 Observational study of gene-disease association. (HuGE Navigator)
19230961 patients with partial DiGeorge syndrome with adequate IL-7 levels would be expected to achieve an almost normal number of peripheral blood T cells with good prognosis.
19155487 The airway response to allergen is associated with the generation of IL-7, which may contribute to airway inflammation by promoting enhanced eosinophil activation and survival in patients with allergic asthma.
19147839 act synergistically with HIV Tat protein to suppress CD127 expression on the surface of CD8 T cells
19147839 IL-7 and CD95 synergistically promote survival and proliferation of HIV-1-latently infected CD4+ T-cells measured by increased levels of integrated HIV-1 DNA, suggesting that HIV-1 IN interacts with IL-7 and CD95 in latently infected CD4+ T-cells
19141282 The SCID mutations of IL-7Ralpha locate outside the binding interface with IL-7, suggesting that the expressed mutations cause protein folding defects in IL-7Ralpha
19092841 A differentially spliced IL-7 isoform, lacking exon 5, leads to STAT-5 phosphorylation in CD4+ and CD8+ T cells, promotes thymocyte maturation and T-cell survival.
19008454 During adulthood CD31(+) naive CD4(+) T cells are maintained by IL-7 and IL-7-based therapies may exert a preferential effect on this population.
19002156 CD40 signals regulate DC-derived IL-7 production that, in turn, may instruct CD8(+) T cells at the time of TCR engagement for survival leading to an increased expansion of antigen-specific T cells
19001329 Data support preclinical observations that IL-7 plays a critical role in inducing acute graft-versus-host-disease.
18976766 Raloxifene reduces circulating levels of interleukin-7 and monocyte chemoattractant protein-1 in postmenopausal women.
18949045 Expressed as soluble recombinant protein in Sf9 cells via nonlysing vector transfection, its secreted levels were 1.7 microg x 1(-1) under serum-free cell culture conditions.
18441236 high IL-7 levels associated with lymphopenic conditions may simultaneously induce sensitivity to Fas-mediated apoptosis in nonactivated T cells and increase Fas-induced costimulatory signals in T cells recognizing low-affinity antigens.
18431516 Data show that T cell loss after islet transplantation in patients with autoimmune type 1 diabetes was associated with both increased serum concentrations of IL-7 and IL-15 and in vivo proliferation of memory CD45RO(+) T cells.
18401975 HCV co-infection does not affect the TREC/IL-7 pathway in HIV disease.
18390701 data show that IL-7- and TCR/CD28-mediated signaling differentially regulate IL-7Ralpha expression on human T cells with a transient and chronic effect, respectively.
18322183 Levels of induced telomerase activity in cultured CD4-positive T cells are inversely correlated with cell death.
18289383 IL-7 may contribute to cartilage destruction in joint diseases, including osteoarthritis.
18158957 IL-7 is an important factor in the development of GVHD, presumably by supporting the survival, proliferation, and possibly activation of alloreactive donor-derived T cells in the recipients.
17956896 IL-7 reduced CD127-surface expression and shedding by CD8+ T cells; results support a role for IL-7 in the down-regulation of CD127 expression and impairment of CTL function observed in HIV infection
17913246 The IL7 gene is very unlikely to influence the genetic susceptibility to MS in this population.
17913246 Observational study of gene-disease association. (HuGE Navigator)
17909291 Stimulation of the IL-7 pathway begins with IL-7 binding to unglycosylated and glycosylated forms of its alpha-receptor, IL-7 receptor alpha.
17894415 Immunolocalization of IL-7, IL-7Ralpha, SDF-1alpha, and CXCR4 resulted in a diffuse but specific labeling. RT-PCR analysis confirmed the expression of the above-mentioned transcripts.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17665400 Activation of the IL-7 pathway may play an important role in lymphoid neogenesis in rheumatoid arthritis synovial tissue.
17656007 IL-7 produced by MS-5 cells is required for human pro-B-cell development from CD34(+)bone marrow cells in our culture system, and IL-7 appears to play a certain role in early human B lymphopoiesis.
17635814 Survival cytokines IL-7 and IL-15 are differentially involved in the growth and maintenance of heart-infiltrating peripheral CD8-positive T cells from patients with chronic Chagas disease cardiomyopathy.
17584976 IL-7 stimulates osteoclastogenesis by inducing TNF-alpha release by T and B cells
17524612 During sleep and especially during late sleep serum interleukin-7 concentrations were distinctly increased as compared to wakefulness.
17438097 IL-7 levels were found to be strongly associated with ovarian cancer.
17373935 A three base ATC deletion just upstream of an out-of-frame ATG codon in the upstream non-coding region of the IL-7 gene, reduces the efficiency of translation from the upstream, out-of-frame ATG.
17328044 IL-7 and, to a limited extent, TNFalpha, both of which are produced by activated monocytes and were detected in synovial fluid, abrogated the CD4+,CD25+ Treg-mediated suppression.
17296584 IL-7 has a major role in the enhanced survival mediated by BM stroma both in T-ALL cells and thymocytes
17284597 The level of IL-7-mediated reduction of apoptosis was inversely correlated with the number of circulating CD4+ T cells. The antiapoptotic effect of IL-7 was uncoupled from the induction of cellular proliferation or endogenous HIV-1 replication
17205128 showed the capability of IL-7 to stimulate spontaneous osteoclastogenesis of bone metastatic patients and to induce osteoclastogenesis in cancer patients without bone involvement
17110377 IL-7 has a distinct inductive effect on APOBEC3G (A3G) deoxycytidine deaminase gene expression and A3G complex assembly that occur in natural cellular targets of human immunodeficiency virus infection.
17053062 CD4+ T-cell lymphopenia has an impact on human B-cell development either directly or indirectly via the associated elevation of IL-7 levels
16967044 IL-7 and CD95 synergistically promote survival and proliferation of HIV-1-latently infected CD4+ T-cells measured by increased levels of integrated HIV-1 DNA, suggesting that HIV-1 IN interacts with IL-7 and CD95 in latently infected CD4+ T-cells
16923550 IL-7 plays a major role in the expansion of mature T-cells that occurs during lymphopenia and has a role in immunotherapy [review]
16709829 IL-7 promotes the extended survival of both naive and memory CD4+ T cells, whereas cycling of these two subsets is distinct and transient.
16626395 IL-7 plasma levels were higher in centenarian females than males.
16322477 IL-7 produced by skin cells contributes to the survival and proliferation of T cells within skin lesions and is likely the source of elevated circulating IL-7 in CTCL.
16284535 findings suggest that higher IL-7 levels may contribute to higher CD4 counts in Hiv-1 infected women
16162475 IL-7, which is increased endogenously in HIV-1-infected individuals late in disease, may be involved in the neuronal apoptosis
16162475 IL-7 and CD95 synergistically promote survival and proliferation of HIV-1-latently infected CD4+ T-cells measured by increased levels of integrated HIV-1 DNA, suggesting that HIV-1 IN interacts with IL-7 and CD95 in latently infected CD4+ T-cells
15993713 Anergy induction by IL-7 and restoration of responsiveness by IL-15 suggest novel mechanisms for regulation of helper T-cell responses, induction of peripheral tolerance, and breakdown of T-cell self-tolerance.
15964403 Transfected into bone marrow stromal cells, protects mice from lukemia following allogeneic T-cell-depleted bone marrow transplantation.
15911446 IL-7 response to T-cell depletion may enhance T-cell production, but at the same time may foster HIV-1 disease progression favoring the emergence of more virulent HIV-1 strains characterized by syncytium-inducing capability and rapid replication rate.
15630452 IL-7 and CD95 synergistically promote survival and proliferation of HIV-1-latently infected CD4+ T-cells measured by increased levels of integrated HIV-1 DNA, suggesting that HIV-1 IN interacts with IL-7 and CD95 in latently infected CD4+ T-cells
15598813 elevated plasma levels of circulating IL-7 in a subgroup of common variable immunodeficiency
15353558 interleukin 7-mediated viability, proliferation, glucose use, and growth of T cell acute lymphoblastic leukemia cells requires PI3 kinase
15247003 Interleukin-7 has a role in rejuvenating the immune system [review]
15226432 Results suggest that the functional interplay between interferon regulatory factors 1 and 2 serves as an elaborate and cooperative mechanism for regulation of interleukin-7 production essential for local immune regulation within human intestinal mucosa.
15133032 Interleukin-7 and transforming growth factor-beta play counter-regulatory roles in protein kinase C-delta-dependent control of fibroblast collagen synthesis in pulmonary fibrosis
15048088 IL-7 induced the death of DN STAT5 expressing 697 cells occurs through caspase-dependent and -independent mechanisms that both require mitochondrial activation.
14978141 Human IL-7 has potent effects on the survival and expansion of T cells that are sufficient to significantly increase lethality of murine graft-vs-host disease in the absence of a conditioning regimen.
14607751 Interaction between IL-7 and its receptor has the major role in modulating T-ALL survival within the microenvironment generated by the T-ALL/TEC interaction.
14601648 the drop in CD4 in HIV children would induce an increase of IL-7 as part of a homeostatic mechanism
14530372 Recombinant human IL-7 induces both a renewal and an expansion of T lymphocytes associated with cell activation in SIVmac-infected macaques without modulation of the other hemopoietic cells and with no increase in the viral load in blood or lymph nodes.
12882655 results confirm a role for SDF-1alpha and IL-7 in HIV-1 disease progression, and suggest that these cytokines play a role in the modulation of CXCR4
12847229 IL-7 confers potent survival signals to some but not all subpopulations of human thymocytes in vitro; in contrast, in vivo administration of IL-7 to SCID/hu Thy/Liv mice is not associated with enhanced thymocyte survival or accelerated HIV infection.
12816983 IL-7 regulates homeostasis by modulating the equilibrium between proliferation and apoptotic cell death in T cells that have recently exited from the thymus as well as mature naive and memory T cell subsets.
12792903 IL-7 and its downstream signalling complex have roles in some human solid malignancies [review]
12742982 A role for IL-7-driven inflammation in atherogenesis was suggested and the promotion of clinical instability in coronary artery disease involving interactions between platelets, monocytes, and chemokines
12441142 C-terminal modification alters biological activity
12433286 Patients with untreated AML had decreased IL-7 serum levels. Patients in complete remission had intermediate levels and developed adverse effects. IL-7 enhanced in vitro proliferation by clone T-cells and these cells responded to IL-2 and Il-7.
12427286 IL-7 has a role in T cell regeneration that may be useful in enhancing immunity in AIDS infection [review]
12149213 IL-7 may function to regulate the milieu of the microenvironment by modulating IL-6 secretion by the IL-7R-expressing stromal elements
12072494 increased HIV replication in the thymus by inducing differentiation and expansion of mature CD27(+) thymocytes expressing CXCR4 or CCR5
12027403 an aromatic residue is required at position 143 of human IL-7 for IL-7R binding and subsequent signal transduction
11929775 Effects on human thymus function.
11927620 IL7 downregulates both TGF-beta production and signaling in pulmonary fibroblasts.
9158092 IL-7 and CD95 synergistically promote survival and proliferation of HIV-1-latently infected CD4+ T-cells measured by increased levels of integrated HIV-1 DNA, suggesting that HIV-1 IN interacts with IL-7 and CD95 in latently infected CD4+ T-cells

AA Sequence

MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRH      1 - 70
ICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEE     71 - 140
NKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH                                     141 - 177
//

Text Mined References (202)

PMID Year Title
27342246 2016 A combinatorial approach of N-terminus blocking and codon optimization strategies to enhance the soluble expression of recombinant hIL-7 in E. coli fed-batch culture.
26615570 2016 Reductions in circulating levels of IL-16, IL-7 and VEGF-A in myalgic encephalomyelitis/chronic fatigue syndrome.
26479922 2015 Hair follicle-derived IL-7 and IL-15 mediate skin-resident memory T cell homeostasis and lymphoma.
26324773 2015 IL-7 Abrogates the Immunosuppressive Function of Human Double-Negative T Cells by Activating Akt/mTOR Signaling.
26272555 2016 IL-7 induces clathrin-mediated endocytosis of CD127 and subsequent degradation by the proteasome in primary human CD8 T cells.
26177551 2015 IL-7 and SCF Levels Inversely Correlate with T Cell Reconstitution and Clinical Outcomes after Cord Blood Transplantation in Adults.
26113403 2015 Decreased serum level of IL-7 in patients with active Graves' disease.
26085358 2015 Effects of Immunoregulatory Cytokines (IL-2, IL-7, and IL-15) on Expression of Gfi1 and U2afll4 Genes in T Cells at Different Stages of Differentiation.
25933188 2015 IL17 Mediates Pelvic Pain in Experimental Autoimmune Prostatitis (EAP).
25870237 2015 Recycled IL-7 Can Be Delivered to Neighboring T Cells.
25784743 2015 Interferon-? inhibits CD4 T cell responses to interleukin-7 and interleukin-2 and selectively interferes with Akt signaling.
25411246 2015 Interleukin 7 up-regulates CD95 protein on CD4+ T cells by affecting mRNA alternative splicing: priming for a synergistic effect on HIV-1 reservoir maintenance.
25393692 2015 Unicompartmental and bicompartmental knee osteoarthritis show different patterns of mononuclear cell infiltration and cytokine release in the affected joints.
25333710 2014 Expression of the IL-7 receptor alpha-chain is down regulated on the surface of CD4 T-cells by the HIV-1 Tat protein.
25263171 2015 T cell reconstitution in allogeneic haematopoietic stem cell transplantation: prognostic significance of plasma interleukin-7.
25184791 2014 Interleukin 7 plays a role in T lymphocyte apoptosis inhibition driven by mesenchymal stem cell without favoring proliferation and cytokines secretion.
25169828 2014 Deficit of interleukin 7 in septic patients.
25063872 2014 IFN-? exerts opposing effects on activation-induced and IL-7-induced proliferation of T cells that may impair homeostatic maintenance of CD4+ T cell numbers in treated HIV infection.
24820104 2014 Effects of different antigenic stimuli on thymic function and interleukin-7/CD127 system in patients with chronic HIV infection.
24750122 2015 Interleukin-7 is decreased and maybe plays a pro-inflammatory function in primary immune thrombocytopenia.
24695377 2014 Interleukin 7 signaling prevents apoptosis by regulating bcl-2 and bax via the p53 pathway in human non-small cell lung cancer cells.
24585897 2014 Inflammatory cytokines drive CD4+ T-cell cycling and impaired responsiveness to interleukin 7: implications for immune failure in HIV disease.
24224652 2014 Interleukin-12 (IL-12), but not IL-23, induces the expression of IL-7 in microglia and macrophages: implications for multiple sclerosis.
24097874 2014 Interleukin-7 mediates selective expansion of tumor-redirected cytotoxic T lymphocytes (CTLs) without enhancement of regulatory T-cell inhibition.
23966629 2013 IL-7 modulates in vitro and in vivo human memory T regulatory cell functions through the CD39/ATP axis.
23963040 2013 Interleukin-7 is produced by afferent lymphatic vessels and supports lymphatic drainage.
23628622 2013 Chimeric ?c cytokine receptors confer cytokine independent engraftment of human T lymphocytes.
23554911 2013 Up-regulation of intestinal epithelial cell derived IL-7 expression by keratinocyte growth factor through STAT1/IRF-1, IRF-2 pathway.
23454917 2013 Human CD4(+) effector T lymphocytes generated upon TCR engagement with self-peptides respond defectively to IL-7 in their transition to memory cells.
23454692 2013 Concentration and activity of the soluble form of the interleukin-7 receptor ? in type 1 diabetes identifies an interplay between hyperglycemia and immune function.
23437070 2013 Kinetics of IL-7 and IL-15 levels after allogeneic peripheral blood stem cell transplantation following nonmyeloablative conditioning.
23325887 2013 IL-7- and IL-15-mediated TCR sensitization enables T cell responses to self-antigens.
23244154 2012 Serum levels of G-CSF and IL-7 in Iranian breast cancer patients.
23188693 2013 Interleukin-7 expression in tears and orbital tissues of patients with Graves' ophthalmopathy.
23160470 2013 IL-7 and IL-15 instruct the generation of human memory stem T cells from naive precursors.
23157741 2012 [Interleukin 7 and its receptor promote cell proliferation and induce lymphangiogenesis in non-small cell lung cancer].
23129754 2012 IL-7 abrogates suppressive activity of human CD4+CD25+FOXP3+ regulatory T cells and allows expansion of alloreactive and autoreactive T cells.
23053510 2012 IL-7 restores lymphocyte functions in septic patients.
23018454 2012 Role of hepatocyte-derived IL-7 in maintenance of intrahepatic NKT cells and T cells and development of B cells in fetal liver.
22955921 2012 IL-7-producing stromal cells are critical for lymph node remodeling.
22949940 2012 Keratinocyte growth factor up-regulates Interleukin-7 expression following intestinal ischemia/reperfusion in vitro and in vivo.
22921903 2012 Correlation between IL-7 and MCP-1 in diabetic chronic non healing ulcer patients at higher risk of coronary artery disease.
22897934 2012 Regulation of in vitro human T cell development through interleukin-7 deprivation and anti-CD3 stimulation.
22859301 2012 Synergistic effects of interleukin-7 and pre-T cell receptor signaling in human T cell development.
22795293 2012 Multiplex analysis of blood cytokines as a prognostic tool in HIV related non-Hodgkin lymphoma patients: a potential role of interleukin-7.
22618230 2012 IL-7 splicing variant IL-7?5 induces human breast cancer cell proliferation via activation of PI3K/Akt pathway.
22506826 2012 Alterations in methylation status of immune response genes promoters in cell-free DNA during a hemodialysis procedure.
22398700 2012 Preterm neonates show marked leukopenia and lymphopenia that are associated with increased regulatory T-cell values and diminished IL-7.
22384197 2012 JunD/AP-1-mediated gene expression promotes lymphocyte growth dependent on interleukin-7 signal transduction.
22314878 2013 Deficit of interleukin-7 in serum of patients with Crohn's disease.
22312161 2012 Increased interleukin (IL)-7R? expression in salivary glands of patients with primary Sjogren's syndrome is restricted to T cells and correlates with IL-7 expression, lymphocyte numbers and activity.
22247488 2012 Increased IL-7 expression in Vogt-Koyanagi-Harada disease.
22194871 2011 IL-7 promotes CD95-induced apoptosis in B cells via the IFN-?/STAT1 pathway.
22113713 2012 The additional value of TGF?1 and IL-7 to predict the course of prostate cancer progression.
22027639 2011 Study of T cell subsets and IL-7 protein expression in HIV-1-infected patients after 7 years HAART.
21920046 2011 HIV infection of thymocytes inhibits IL-7 activity without altering CD127 expression.
21912394 2012 IPSS-independent prognostic value of plasma CXCL10, IL-7 and IL-6 levels in myelodysplastic syndromes.
21876448 2011 Longitudinal assessment of interleukin 7 plasma levels in HIV-infected patients in the absence of and under antiretroviral therapy.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21795588 2011 IL-7 promotes T(H)1 development and serum IL-7 predicts clinical response to interferon-? in multiple sclerosis.
21753149 2011 IL-7 dysregulation and loss of CD8+ T cell homeostasis in the monogenic human disease autoimmune polyendocrinopathy-candidiasis-ectodermal dystrophy.
21711552 2011 Post-operative infection and sepsis in humans is associated with deficient gene expression of ?c cytokines and their apoptosis mediators.
21680796 2011 IL-7R expression and IL-7 signaling confer a distinct phenotype on developing human B-lineage cells.
21647866 2011 Characterization of interleukin-7 and interleukin-7 receptor in the pathogenesis of rheumatoid arthritis.
21455214 2011 Intracellular reactive oxygen species are essential for PI3K/Akt/mTOR-dependent IL-7-mediated viability of T-cell acute lymphoblastic leukemia cells.
21418620 2011 Increase of plasma IL-9 and decrease of plasma IL-5, IL-7, and IFN-? in patients with chronic heart failure.
21257970 2011 CD4 and CD8 T cell immune activation during chronic HIV infection: roles of homeostasis, HIV, type I IFN, and IL-7.
21239710 2011 Elevated IL-7 availability does not account for T cell proliferation in moderate lymphopenia.
21209878 2010 Increased bone marrow interleukin-7 (IL-7)/IL-7R levels but reduced IL-7 responsiveness in HIV-positive patients lacking CD4+ gain on antiviral therapy.
21159243 2010 [The expressions of IL-7 and IL-7R and the relationship between them with lymph node metastasis and prognosis in non-small cell lung cancer].
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20815339 2010 A biosensor study indicating that entropy, electrostatics, and receptor glycosylation drive the binding interaction between interleukin-7 and its receptor.
20673240 2010 Interleukin-7 enhances memory CD8(+) T-cell recall responses in health but its activity is impaired in human immunodeficiency virus infection.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20546594 2010 An application of Random Forests to a genome-wide association dataset: methodological considerations & new findings.
20505146 2010 IL-7-dependent B lymphocytes are essential for the anti-polysaccharide response and protective immunity to Streptococcus pneumoniae.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20465565 2010 Interleukin-7 promotes the survival of human CD4+ effector/memory T cells by up-regulating Bcl-2 proteins and activating the JAK/STAT signalling pathway.
20386468 2010 IL-7 enhances survival of human CD56bright NK cells.
20382196 2010 Serum IL-7 and G-CSF in major depressive disorder.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20226540 2010 Alternative splicing of interleukin-7 (IL-7) and interleukin-7 receptor alpha (IL-7Ralpha) in peripheral blood from patients with multiple sclerosis (MS).
20200205 2010 Interleukin-7 mediates glucose utilization in lymphocytes through transcriptional regulation of the hexokinase II gene.
20190194 2010 IL-7 induces rapid clathrin-mediated internalization and JAK3-dependent degradation of IL-7Ralpha in T cells.
20190192 2010 IL-7 and IL-21 are superior to IL-2 and IL-15 in promoting human T cell-mediated rejection of systemic lymphoma in immunodeficient mice.
20167604 2010 Interleukin-7 compartmentalizes its receptor signaling complex to initiate CD4 T lymphocyte response.
20131250 2010 Increased expression of interleukin-7 in labial salivary glands of patients with primary Sjögren's syndrome correlates with increased inflammation.
20089933 2010 IL-7 is expressed and secreted by human skeletal muscle cells.
20067635 2010 Bone invading NSCLC cells produce IL-7: mice model and human histologic data.
20035760 2010 A validated assay to measure soluble IL-7 receptor shows minimal impact of IL-7 treatment.
19923894 2009 Interplay between BMP4 and IL-7 in human intrathymic precursor cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19904747 2010 Association between polymorphisms in interleukin-17A and interleukin-17F genes and risks of gastric cancer.
19889552 2010 Impaired IL-7 signaling may explain a case of atypical JAK3-SCID.
19864382 2010 Dual mechanism of impairment of interleukin-7 (IL-7) responses in human immunodeficiency virus infection: decreased IL-7 binding and abnormal activation of the JAK/STAT5 pathway.
19847194 2010 Interleukin-7 (IL-7) and IL-7 splice variants affect differentiation of human neural progenitor cells.
19796902 2010 A validated capillary electrophoresis method to check for batch-to-batch consistency during recombinant human glycosylated interleukin-7 production campaigns.
19770269 2009 TSLP and IL-7 use two different mechanisms to regulate human CD4+ T cell homeostasis.
19714586 2009 Elevated expression of interleukin-7 receptor in inflamed joints mediates interleukin-7-induced immune activation in rheumatoid arthritis.
19675167 2009 Self-peptides prolong survival in murine autoimmunity via reduced IL-2/IL-7-mediated STAT5 signaling, CD8 coreceptor, and V alpha 2 down-regulation.
19432535 2009 Responsiveness of T cells to interleukin-7 is associated with higher CD4+ T cell counts in HIV-1-positive individuals with highly active antiretroviral therapy-induced viral load suppression.
19366834 2009 The lack of epithelial interleukin-7 and BAFF/BLyS gene expression in prostate cancer as a possible mechanism of tumor escape from immunosurveillance.
19299724 2009 IL-7 Dependence in human B lymphopoiesis increases during progression of ontogeny from cord blood to bone marrow.
19279003 2009 Overexpression of REIC/Dkk-3 in normal fibroblasts suppresses tumor growth via induction of interleukin-7.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19248116 2009 Interleukin-7 stimulates secretion of S100A4 by activating the JAK/STAT signaling pathway in human articular chondrocytes.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19230961 2009 Role of IL-7 in the regulation of T-cell homeostasis in partial DiGeorge syndrome.
19155487 2009 Potential contribution of IL-7 to allergen-induced eosinophilic airway inflammation in asthma.
19147839 2009 IL-7 and the HIV Tat protein act synergistically to down-regulate CD127 expression on CD8 T cells.
19141282 2009 Structural and biophysical studies of the human IL-7/IL-7Ralpha complex.
19092841 2009 Expression analysis and functional activity of interleukin-7 splice variants.
19008454 2009 IL-7 sustains CD31 expression in human naive CD4+ T cells and preferentially expands the CD31+ subset in a PI3K-dependent manner.
19002156 2009 CD40 regulates human dendritic cell-derived IL-7 production that, in turn, contributes to CD8(+) T-cell antigen-specific expansion.
19001329 2008 Association of serum interleukin-7 levels with the development of acute graft-versus-host disease.
18976766 2009 Raloxifene reduces circulating levels of interleukin-7 and monocyte chemoattractant protein-1 in postmenopausal women.
18949045 2009 Nonviral production of human interleukin-7 in spodoptera frugiperda insect cells as a soluble recombinant protein.
18441236 2008 Priming of T cells to Fas-mediated proliferative signals by interleukin-7.
18431516 2008 Islet transplantation in patients with autoimmune diabetes induces homeostatic cytokines that expand autoreactive memory T cells.
18401975 HCV co-infection does not affect the TREC/IL-7 pathway in HIV disease.
18390701 2008 Differential regulation of human IL-7 receptor alpha expression by IL-7 and TCR signaling.
18322183 2008 Telomerase is involved in IL-7-mediated differential survival of naive and memory CD4+ T cells.
18289383 2008 Human articular chondrocytes produce IL-7 and respond to IL-7 with increased production of matrix metalloproteinase-13.
18158957 2008 Importance of interleukin-7 in the development of experimental graft-versus-host disease.
17956896 2007 IL-7 decreases IL-7 receptor alpha (CD127) expression and induces the shedding of CD127 by human CD8+ T cells.
17913246 2007 Genetic association analysis of the interleukin 7 gene (IL7) in multiple sclerosis.
17909291 2007 Crystallization and preliminary X-ray diffraction of human interleukin-7 bound to unglycosylated and glycosylated forms of its alpha-receptor.
17894415 2008 Functional interleukin-7/interleukin-7Ralpha, and SDF-1alpha/CXCR4 are expressed by human periodontal ligament derived mesenchymal stem cells.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17665400 2007 Inflammation and ectopic lymphoid structures in rheumatoid arthritis synovial tissues dissected by genomics technology: identification of the interleukin-7 signaling pathway in tissues with lymphoid neogenesis.
17656007 2007 Interleukin-7 contributes to human pro-B-cell development in a mouse stromal cell-dependent culture system.
17635814 Locally produced survival cytokines IL-15 and IL-7 may be associated to the predominance of CD8+ T cells at heart lesions of human chronic Chagas disease cardiomyopathy.
17584976 2007 IL-7 modulates osteoclastogenesis in patients affected by solid tumors.
17524612 2007 Sleep enhances serum interleukin-7 concentrations in humans.
17438097 2007 Serum cytokine profiling as a diagnostic and prognostic tool in ovarian cancer: a potential role for interleukin 7.
17373935 2007 A three-base-deletion polymorphism in the upstream non-coding region of human interleukin 7 (IL-7) gene could enhance levels of IL-7 expression.
17328044 2007 Proinflammatory mediator-induced reversal of CD4+,CD25+ regulatory T cell-mediated suppression in rheumatoid arthritis.
17296584 2007 Interleukin 7 requirement for survival of T-cell acute lymphoblastic leukemia and human thymocytes on bone marrow stroma.
17284597 2007 Interleukin 7 reduces the levels of spontaneous apoptosis in CD4+ and CD8+ T cells from HIV-1-infected individuals.
17205128 2006 IL-7 up-regulates TNF-alpha-dependent osteoclastogenesis in patients affected by solid tumor.
17110377 2007 Distinct patterns of cytokine regulation of APOBEC3G expression and activity in primary lymphocytes, macrophages, and dendritic cells.
17053062 2007 Idiopathic CD4+ T lymphocytopenia is associated with increases in immature/transitional B cells and serum levels of IL-7.
16923550 2006 IL-7 in allogeneic transplant: clinical promise and potential pitfalls.
16709829 2006 IL-7R alpha gene expression is inversely correlated with cell cycle progression in IL-7-stimulated T lymphocytes.
16626395 2006 Thymic output and functionality of the IL-7/IL-7 receptor system in centenarians: implications for the neolymphogenesis at the limit of human life.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16322477 2006 Skin-derived interleukin-7 contributes to the proliferation of lymphocytes in cutaneous T-cell lymphoma.
16284535 2005 Increased circulating interleukin-7 levels in HIV-1-infected women.
16162475 2005 Exogenous IL-7 induces Fas-mediated human neuronal apoptosis: potential effects during human immunodeficiency virus type 1 infection.
15993713 2005 Coculture of Th cells with interleukin (IL)-7 in the absence of antigenic stimuli induced T-cell anergy reversed by IL-15.
15964403 2005 Antileukemic effect of interleukin-7-transduced bone marrow stromal cells in mice following allogeneic T-cell-depleted bone marrow transplantation.
15911446 2005 High IL-7 plasma levels may induce and predict the emergence of HIV-1 virulent strains in pediatric infection.
15598813 2005 Abnormal interleukin-7 function in common variable immunodeficiency.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15353558 2004 Activation of PI3K is indispensable for interleukin 7-mediated viability, proliferation, glucose use, and growth of T cell acute lymphoblastic leukemia cells.
15247003 2004 Interleukin-7: an interleukin for rejuvenating the immune system.
15226432 2004 Interferon regulatory factor 1 (IRF-1) and IRF-2 distinctively up-regulate gene expression and production of interleukin-7 in human intestinal epithelial cells.
15133032 2004 Interleukin-7 and transforming growth factor-beta play counter-regulatory roles in protein kinase C-delta-dependent control of fibroblast collagen synthesis in pulmonary fibrosis.
15048088 2004 Interleukin-7 induces apoptosis of 697 pre-B cells expressing dominant-negative forms of STAT5: evidence for caspase-dependent and -independent mechanisms.
15028279 2004 PCR isolation and cloning of novel splice variant mRNAs from known drug target genes.
14978141 2004 Host conditioning is a primary determinant in modulating the effect of IL-7 on murine graft-versus-host disease.
14607751 2003 Thymic epithelial cells promote survival of human T-cell acute lymphoblastic leukemia blasts: the role of interleukin-7.
14601648 2003 Increased interleukin-7 plasma levels are associated with recovery of CD4+ T cells in HIV-infected children.
14530372 2003 IL-7 stimulates T cell renewal without increasing viral replication in simian immunodeficiency virus-infected macaques.
12882655 2003 Circulating levels of stromal cell-derived factor 1alpha and interleukin 7 in HIV type 1 infection and pulmonary tuberculosis are reciprocally related to CXCR4 expression on peripheral blood leukocytes.
12847229 2003 Effects of IL-7 on early human thymocyte progenitor cells in vitro and in SCID-hu Thy/Liv mice.
12816983 2003 Homeostasis of naive and memory CD4+ T cells: IL-2 and IL-7 differentially regulate the balance between proliferation and Fas-mediated apoptosis.
12792903 2003 Interleukin-7 (IL-7) and IL-7 receptor (IL-7R) signalling complex in human solid tumours.
12742982 2003 Interleukin-7-mediated inflammation in unstable angina: possible role of chemokines and platelets.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12441142 2002 Altered biological activity associated with C-terminal modifications of IL-7.
12433286 2002 Interleukin-7 (IL-7) in patients receiving intensive chemotherapy for acute myelogenous leukemia: studies of systemic IL-7 Levels and IL-7 responsiveness of circulating T lymphocytes.
12427286 2002 Interleukin-7 and immunorestoration in HIV: beyond the thymus.
12149213 2002 Functional interleukin-7 receptors (IL-7Rs) are expressed by marrow stromal cells: binding of IL-7 increases levels of IL-6 mRNA and secreted protein.
12072494 2002 Impact of cytokines on replication in the thymus of primary human immunodeficiency virus type 1 isolates from infants.
12027403 2002 Structure function analysis of interleukin 7: requirement for an aromatic ring at position 143 of helix D.
12010786 2002 Interleukin-7: from bench to clinic.
11858939 2002 Interleukin-7 receptor expression and activation in nonhaematopoietic neoplastic cell lines.
11672535 2001 Pre-B cell receptor signaling mediates selective response to IL-7 at the pro-B to pre-B cell transition via an ERK/MAP kinase-dependent pathway.
11564764 2001 Cutting edge: Identification of a hybrid cytokine consisting of IL-7 and the beta-chain of the hepatocyte growth factor/scatter factor.
11447288 2001 IL-7 is critical for homeostatic proliferation and survival of naive T cells.
10850801 2000 Comparative model building of interleukin-7 using interleukin-4 as a template: a structural hypothesis that displays atypical surface chemistry in helix D important for receptor activation.
10390077 1999 Biological and clinical implications of interleukin-7 and lymphopoiesis.
9561370 1998 Human dendritic cells express functional interleukin-7.
9493287 1997 Modulation of cytokine gene expression by thymic lympho-stromal cell to cell interaction: effect of retinoic acid.
9475337 1997 Human small intestinal epithelial cells secrete interleukin-7 and differentially express two different interleukin-7 mRNA Transcripts: implications for extrathymic T-cell differentiation.
9407080 1997 Disulfide bond assignment in human interleukin-7 by matrix-assisted laser desorption/ionization mass spectroscopy and site-directed cysteine to serine mutational analysis.
9215626 1997 Bcl-2 rescues T lymphopoiesis in interleukin-7 receptor-deficient mice.
9200446 1997 TGF-beta down-regulates stromal IL-7 secretion and inhibits proliferation of human B cell precursors.
9010926 1996 Homology modeling study of the human interleukin-7 receptor complex.
8862549 1996 Prediction of the three-dimensional structure of human interleukin-7 by homology modeling.
8840152 1996 Interleukin-7. Biology and implications for dermatology.
8473051 1993 Interleukin 7 enhances the proliferation and effector function of tumor-infiltrating lymphocytes from renal-cell carcinoma.
8266077 1993 Interleukin-2 receptor gamma chain: a functional component of the interleukin-7 receptor.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7769137 1995 Interleukin 7 is produced by human intestinal epithelial cells and regulates the proliferation of intestinal mucosal lymphocytes.
7686307 1993 Interleukin-7: a cofactor for V(D)J rearrangement of the T cell receptor beta gene.
2786840 1989 The gene for human interleukin 7 (IL7) is at 8q12-13.
2643102 1989 Human interleukin 7: molecular cloning and growth factor activity on human and murine B-lineage cells.
2329282 1990 Characterization of the human and murine IL-7 genes.
2320434 1990 An STS in the human IL7 gene located at 8q12-13.