Property Summary

NCBI Gene PubMed Count 105
PubMed Score 151.74
PubTator Score 209.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Atopic dermatitis 952 5.3e-08
psoriasis 6694 1.8e-05
lung adenocarcinoma 2716 1.7e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
Atopic dermatitis -4.800 5.3e-08
lung adenocarcinoma 1.100 1.7e-04
psoriasis -2.600 1.8e-05

Gene RIF (85)

AA Sequence

MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTSPKVKNLNPKKFSIHDQDHKVL      1 - 70
VLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKL     71 - 140
MKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAE    141 - 210
MSPSEVSD                                                                  211 - 218
//

Text Mined References (106)

PMID Year Title