Property Summary

NCBI Gene PubMed Count 79
PubMed Score 109.75
PubTator Score 209.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 9.3e-38
Atopic dermatitis 944 5.3e-08
lung adenocarcinoma 2714 3.4e-03

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -3.000 9.3e-38
Atopic dermatitis -4.800 5.3e-08
lung adenocarcinoma 1.700 3.4e-03

Synonym

Accession Q9NZH6 B5BU97 Q56AP9 Q8TD04 Q8TD05 Q9HBF2 Q9HBF3 Q9UHA6
Symbols FIL1
FIL1Z
IL-1H
IL-37
IL1F7
IL1H4
IL-1F7
IL-1H4
IL1RP1
IL-1RP1
FIL1(ZETA)

Gene

  Ortholog (1)

Species Source Disease
Macaque EggNOG Inparanoid

Gene RIF (59)

PMID Text
26791086 Findings show IL-37 mRNA and protein expressions significantly decreased in non-small cell lung cancer and demonstrate its protective role possibly through inhibiting tumor angiogenesis.
26561030 these data suggest a special role for IL-37 in asthma pathogenesis
26547368 The results suggest serum IL-37 levels were increased in rheumatoid arthritis (RA) patients and were positively associated with disease activity, IL-17/IL-23 and bone loss in RA, suggesting that IL-37 may play a critical role in the pathogenesis of RA.
26515414 Suggest that IL-37 is a novel and potent proangiogenic cytokine.
26464282 The expression of IL-37 was decreased in renal cell carcinoma patients and was negatively correlated with tumor progression.
26454413 IL-37 is an important cytokine in the control of asthma by suppressing the production of inflammatory cytokines.
26411375 These results demonstrated that IL-37 might manifest as a critical protein involving in immunosuppression of human CD4(+)CD25(+)Tregs.
26373794 Our study strongly supports that the IL37 gene variants are associated with the susceptibility to AITD.
26319074 Letter: Expression of IL-37 is decreased in psoriatic skin.
26253248 Interleukin-37 expression is decreased in Behcet's disease and is associated with inflammation
26159110 IL-37 is an important anti-inflammatory cytokine in the control of RA pathogenesis by suppressing inflammatory cytokine production
26073153 IL-37 may be a novel research target to understand the pathogenesis of tuberculosis infection.
26008726 The serum level of IL-37 was found to be significantly increased in multiple sclerosis and neuromyelitis optica patients compared to healthy controls.
25960620 IL-37 does not play an important role in the systematic inflammatory response but may be involved in leukocytic inflammation in ASTEMI after percutaneous coronary intervention
25917106 IL-37 plays a potent immunosuppressive role in the pathogenesis of human rheumatoid arthritis and mouse collagen-induced arthritis models via the downregulation of IL-17 and IL-17-triggering cytokine production and the curbing of Th17 cell proliferation.
25879630 our data shows that the level of IL-37 mRNA is affected by chronic HIV-1-infection.
25854573 Patients with active pulmonary tuberculosis present with significantly increased level of plasma IL-37.
25729923 IL-37 requires the receptors IL-18Ralpha and IL-1R8 to carry out its multifaceted anti-inflammatory program upon innate signal transduction.
25654981 IL-37 acts as an extracellular cytokine by binding to the IL-18 receptor but using the IL-1R8 for its anti-inflammatory properties.
25627863 Higher levels of IL-37 were found in ankylosing spondylitis patients, which were correlated with disease activity.
25559248 Thus, this method provides an efficient way to obtain an active IL-37 with high yield and high purity.
25557042 IL-37 requires IL-18Ralpha and SIGIRR/IL-1R8 to diminish allergic airway inflammation in mice
25541254 hBD-3 stimulates IL-37 expression through CCR6 in keratinocytes
25308753 research demonstrated, for the first time, that anti-inflammatory active components (triptolide and triptonide) upregulated the expression of IL-37 most likely via activation of the ERK1/2 and p38 MAPK pathways.
25294929 DCs expressing IL-37 are tolerogenic, thereby impairing activation of effector T-cell responses and inducing Treg cells
25226272 the expression of IL-37 is correlated with the disease activity of GD, and contribute to suppress inflammation cytokines TNF-alpha, IL-6, and IL-17 during GD pathogenesis.
25214710 IL-35 and IL-37 protein expressions were higher in IBD patients compared with controls.
25207880 tubular epithelial cells express the IL-18 contra-regulatory protein IL-37 as an endogenous control mechanism to reduce inflammation
25182023 IL-37 as an important anti-inflammatory modulator during obesity-induced inflammation and insulin resistance.
24898887 Low Interleukin-37 expression is associated with hepatocellular carcinoma.
24796748 Data indicate that anti-IL-37 antibody with high titer and specificity was successfully prepared.
24788826 IL-37 expression in RA and during DMARD treatment appears to be controlled by the level of pro-inflammatory cytokines. This results in a strong correlation between plasma levels of IL-37 and disease activity in RA patients.
24787052 show here that IL1A, IL1B and IL1F7 regulatory regions come in close proximity in LPS stimulated cells but not in resting human monocytes
24733959 plasma IL-37 levels are associated with the onset of acute coronary syndrome
24730521 We conclude that a decreased IL-37 expression in active BD patients may trigger the production of pro-inflammatory cytokines and ROS in association with activation of Th1 and Th17 cells by DCs.
24629023 IL-37 associated with SLE disease activity, especially related with systemic Lupus erythematosus renal disease activity.
24551286 Downregulation of IL-37 expression appeared to result in overexpression of pro-inflammatory cytokines in degenerative disc disease.
24481253 Although caspase-1 is required for nuclear translocation of intracellular IL-37 and for secretion of mature IL-37, the release of the IL-37 precursor is independent of caspase-1 activation.
24453242 these studies strongly indicate that IL-37 plays a potent immunosuppressive role in the pathogenesis of both experimental psoriasis models in vitro and in vivo by downregulating proinflammatory cytokines.
24357513 functional polymorphism, IL1f7 rs3811047 G>A, might contribute to gastric cardiac adenocarcinoma (GCA) susceptibility.
24174711 cerebrospinal fluid and plasma interleukin-37 are elevated and may play a role in Guillain-Barre syndrome
23697556 that IL-37 may play a significant role in the immune response of CHB patients with HBeAg seroconversion. The serum levels of IL-37 are associated with liver damage in CHB patients.
23600829 IL-37b may be involved in the pathophysiology of inflammatory bowel disease as an anti-inflammatory cytokine and an inhibitor of both innate and acquired immune responses.
23182761 IL37 may play a role in the pathogenesis of atopic dermatitis by modulating innate immune reactions.
23171316 the A allele of IL-1F7 gene (rs3811047) may have a protective effect on rheumatoid arthritis.
23159404 Data indicate that IL-1alpha binds stronger to nuclear structures than IL-33 and IL-37.
22646996 IL-37 is protective against hepatic ischemia-reperfusion injury.
21873195 IL-37 is a key modulator of intestinal inflammation, and its expression protects mice from experimental colitis.
21394384 Data show that weight loss led to a significant reduction in liver IL-1beta, IL-18 and IL-1Ra expression, whereas hepatic IL-37 expression remained stable, adipose/liver NLRP3 inflammasome and IL-1alpha expression were not affected by weight loss.
21072596 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20935647 IL-37 thus emerges as a natural suppressor of innate inflammatory and immune responses
20237496 Observational study of gene-disease association. (HuGE Navigator)
20141484 Observational study of gene-disease association. (HuGE Navigator)
19874811 Observational study of gene-disease association. (HuGE Navigator)
18484691 Observational study of gene-disease association. (HuGE Navigator)
18390730 results demonstrate that IL-1F7b translocates to the nucleus after caspase-1 processing and may act as a transcriptional modulator reducing the production of LPS-stimulated proinflammatory cytokines
12496389 IL-1F7 plays an important role in the link between innate and adaptive immunity and has the ability to inhibit tumor growth following adenovirus-mediated gene transfer.
12381835 after binding to IL-18BP, IL-1F7b forms a complex with IL-18Rbeta, depriving the beta-chain of forming a functional receptor complex with IL-18Ralpha and thus inhibiting IL-18 activity
12096920 caspase-1 cleaves IL-1F7b at the predicted site to generate mature IL-1F7b

AA Sequence

MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTSPKVKNLNPKKFSIHDQDHKVL      1 - 70
VLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKL     71 - 140
MKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAE    141 - 210
MSPSEVSD                                                                  211 - 218
//

Text Mined References (80)

PMID Year Title
26791086 2016 Interleukin-37 suppresses tumor growth through inhibition of angiogenesis in non-small cell lung cancer.
26561030 2015 Allergic airway inflammation: unravelling the relationship between IL-37, IL-18R? and Tir8/SIGIRR.
26547368 2015 Elevated serum levels of Interleukin-37 are associated with inflammatory cytokines and disease activity in rheumatoid arthritis.
26515414 2015 IL-37 Is a Novel Proangiogenic Factor of Developmental and Pathological Angiogenesis.
26464282 2015 IL-37 mediates the antitumor activity in renal cell carcinoma.
26454413 2016 Anti-inflammatory activity of IL-37 in asthmatic children: Correlation with inflammatory cytokines TNF-?, IL-?, IL-6 and IL-17A.
26411375 2015 Expression of IL-37 contributes to the immunosuppressive property of human CD4+CD25+ regulatory T cells.
26373794 2015 Polymorphism of IL37 gene as a protective factor for autoimmune thyroid disease.
26319074 2015 Expression of IL-36 family cytokines and IL-37 but not IL-38 is altered in psoriatic skin.
26253248 2015 Interleukin-37 expression is decreased in Behçet's disease and is associated with inflammation.
26159110 2015 Elevated serum and synovial fluid levels of interleukin-37 in patients with rheumatoid arthritis: Attenuated the production of inflammatory cytokines.
26073153 2015 IL-37 Expression is Upregulated in Patients with Tuberculosis and Induces Macrophages Towards an M2-like Phenotype.
26008726 2015 Increased serum level of IL-37 in patients with multiple sclerosis and neuromyelitis optica.
25960620 2015 The evaluation of plasma and leukocytic IL-37 expression in early inflammation in patients with acute ST-segment elevation myocardial infarction after PCI.
25917106 2015 IL-37 Alleviates Rheumatoid Arthritis by Suppressing IL-17 and IL-17-Triggering Cytokine Production and Limiting Th17 Cell Proliferation.
25879630 2015 Interleukin-37 Expression Is Increased in Chronic HIV-1-Infected Individuals and Is Associated with Inflammation and the Size of the Total Viral Reservoir.
25854573 2015 [Clinical detection and significance of plasma IL-37 in patients with active pulmonary tuberculosis].
25729923 2015 IL-37 requires the receptors IL-18R? and IL-1R8 (SIGIRR) to carry out its multifaceted anti-inflammatory program upon innate signal transduction.
25654981 2015 Extracellular forms of IL-37 inhibit innate inflammation in vitro and in vivo but require the IL-1 family decoy receptor IL-1R8.
25627863 2015 Interleukin-37 is increased in ankylosing spondylitis patients and associated with disease activity.
25559248 2015 High-level expression and one-step purification of a soluble recombinant human interleukin-37b in Escherichia coli.
25557042 2015 IL-37 requires IL-18R? and SIGIRR/IL-1R8 to diminish allergic airway inflammation in mice.
25541254 2015 Human ?-defensin-3 increases the expression of interleukin-37 through CCR6 in human keratinocytes.
25308753 2015 Modulation of IL-37 expression by triptolide and triptonide in THP-1 cells.
25294929 2014 Suppression of antigen-specific adaptive immunity by IL-37 via induction of tolerogenic dendritic cells.
25226272 2014 Increased expression of IL-37 in patients with Graves' disease and its contribution to suppression of proinflammatory cytokines production in peripheral blood mononuclear cells.
25214710 2014 The possible role of the novel cytokines il-35 and il-37 in inflammatory bowel disease.
25207880 2015 IL-37 inhibits IL-18-induced tubular epithelial cell expression of pro-inflammatory cytokines and renal ischemia-reperfusion injury.
25182023 2014 IL-37 protects against obesity-induced inflammation and insulin resistance.
24898887 2014 Interleukin-37 mediates the antitumor activity in hepatocellular carcinoma: role for CD57+ NK cells.
24796748 2014 [The expression of human IL-37 in E.coli and preparation and characterization of mouse anti-IL-37 antibody].
24788826 2014 Plasma levels of IL-37 and correlation with TNF-?, IL-17A, and disease activity during DMARD treatment of rheumatoid arthritis.
24787052 2014 Long-range DNA interactions at the IL-1/IL-36/IL-37 gene cluster (2q13) are induced by activation of monocytes.
24733959 2014 Elevated plasma IL-37, IL-18, and IL-18BP concentrations in patients with acute coronary syndrome.
24730521 2014 A possible role for interleukin 37 in the pathogenesis of Behcet's disease.
24629023 2014 IL-37 inhibits the production of inflammatory cytokines in peripheral blood mononuclear cells of patients with systemic lupus erythematosus: its correlation with disease activity.
24554482 2014 Genome-wide association study of peripheral neuropathy with D-drug-containing regimens in AIDS Clinical Trials Group protocol 384.
24551286 2014 Downregulated interleukin 37 expression associated with aggravation of intervertebral disc degeneration.
24481253 2014 Role of caspase-1 in nuclear translocation of IL-37, release of the cytokine, and IL-37 inhibition of innate immune responses.
24453242 2014 IL-37 ameliorates the inflammatory process in psoriasis by suppressing proinflammatory cytokine production.
24357513 2014 The variant interleukin 1f7 rs3811047 G>A was associated with a decreased risk of gastric cardiac adenocarcinoma in a Chinese Han population.
24174711 2013 Elevated levels of cerebrospinal fluid and plasma interleukin-37 in patients with Guillain-Barré syndrome.
23932459 2014 Genome-wide association study of lung function phenotypes in a founder population.
23697556 2013 Serum interleukin-37 concentrations and HBeAg seroconversion in chronic HBV patients during telbivudine treatment.
23600829 2013 Epithelial expression of interleukin-37b in inflammatory bowel disease.
23182761 2013 Interleukin-37 is elevated in subjects with atopic dermatitis.
23171316 2013 Associations of the IL-1F7 gene polymorphisms with rheumatoid arthritis in Chinese Han population.
23159404 2013 Analysis of nuclear localization of interleukin-1 family cytokines by flow cytometry.
22646996 2012 Interleukin-37 reduces liver inflammatory injury via effects on hepatocytes and non-parenchymal cells.
21873195 2011 Interleukin 37 expression protects mice from colitis.
21394384 2011 Adipose and liver expression of interleukin (IL)-1 family members in morbid obesity and effects of weight loss.
21072596 2011 Analysis on the interaction between IL-1F7 gene and environmental factors on patients with ankylosing spondylitis: a case-only study.
20935647 2010 IL-37 is a fundamental inhibitor of innate immunity.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20141484 2010 The interleukin-1 family gene polymorphisms in Korean patients with rheumatoid arthritis.
19874811 2010 Association of IL-1F7 gene with susceptibility to human leukocyte antigen-B27 positive ankylosing spondylitis in Han Chinese population.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18484691 2008 Interleukin 1 polymorphisms in patients with ankylosing spondylitis in Korea.
18390730 2008 The IL-1 family member 7b translocates to the nucleus and down-regulates proinflammatory cytokines.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15527767 2004 Proteomics-based identification of proteins interacting with Smad3: SREBP-2 forms a complex with Smad3 and inhibits its transcriptional activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12496389 2003 Innate immunity mediated by the cytokine IL-1 homologue 4 (IL-1H4/IL-1F7) induces IL-12-dependent adaptive and profound antitumor immunity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12381835 2002 A complex of the IL-1 homologue IL-1F7b and IL-18-binding protein reduces IL-18 activity.
12096920 2002 Interleukin-1F7B (IL-1H4/IL-1F7) is processed by caspase-1 and mature IL-1F7B binds to the IL-18 receptor but does not induce IFN-gamma production.
11991723 2002 Genomic organization of the interleukin-1 locus.
11991722 2002 A sequence-based map of the nine genes of the human interleukin-1 cluster.
11574262 2001 A new nomenclature for IL-1-family genes.
11466363 2001 Two novel IL-1 family members, IL-1 delta and IL-1 epsilon, function as an antagonist and agonist of NF-kappa B activation through the orphan IL-1 receptor-related protein 2.
11278614 2001 Cloning and characterization of IL-1HY2, a novel interleukin-1 family member.
11145836 2001 IL-1H, an interleukin 1-related protein that binds IL-18 receptor/IL-1Rrp.
11093146 2000 A tissue specific IL-1 receptor antagonist homolog from the IL-1 cluster lacks IL-1, IL-1ra, IL-18 and IL-18 antagonist activities.
10860666 2000 Identification and gene organization of three novel members of the IL-1 family on human chromosome 2.
10744718 2000 Identification and initial characterization of four novel members of the interleukin-1 family.
10625660 2000 Four new members expand the interleukin-1 superfamily.
10512743 1999 IL1HY1: A novel interleukin-1 receptor antagonist gene.
9169134 1997 Molecular cloning of the interleukin-1 gene cluster: construction of an integrated YAC/PAC contig and a partial transcriptional map in the region of chromosome 2q13.
8188271 1994 A physical map of the region encompassing the human interleukin-1 alpha, interleukin-1 beta, and interleukin-1 receptor antagonist genes.