Property Summary

NCBI Gene PubMed Count 62
PubMed Score 403.37
PubTator Score 62.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.900 3.6e-11

Synonym

Accession Q9UBH0 A8K2I4 Q56AT9 Q7RTZ6 IL-36Ra
Symbols FIL1
FIL1D
IL1F5
IL1L1
PSORP
IL1HY1
IL1RP3
IL36RA
IL-36Ra
PSORS14
FIL1(DELTA)

Gene

PDB

4P0J   4P0K   4P0L  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (41)

PMID Text
26676204 The present study identified IL-36RN in various species and investigated the associations between IL-36RN and cancer prognosis.
26589685 generalized pustular psoriasis and early onset, ever generalized pustular psoriasis (more than two attacks), ever acrodermatitis continua of Hallopeau, inverse psoriasis, and a family history of pustular psoriasis were associated with IL36RN mutation.
25989471 IL36RN missense mutation was not associated with psoriasis.
25897967 IL36RN was identified as strong regulators of skin pathology in both lesional and non-lesional skin samples.
25688670 We identified a novel homozygous missense mutation in IL36RN in two siblings, and showed the molecular basis of the condition to be both distinct from psoriasis and distinct between the two families studied.
25615897 we report T123M and 115+6T>C mutations, both homozygous in nature, in two Japanese individuals with Zumbusch type of generalized pustular psoriasis.
25468355 identified a novel IL36RN missense mutation, c.334G > A in exon 5, that caused p.E112K substitution and was located adjacent to a 113 amino acid residue in generalized pustular psoriasis
25458002 The study found that IL36RN alleles define a generalized pustular psoriasis phenotype characterized by early onset, high risk of systemic inflammation, and low prevalence of psoriasis vulgaris.
25212972 found 2 new variants and 4 known IL36RN variants in 29 generalized pustular psoriasis patients
24979538 in a Chinese Daur family with generalized pustular psoriasis, identified a homozygous splice site mutation c.115+6T>C in intron 3 in both patients; other 4 family members and 7 healthy controls carried heterozygous c.115+6T>C mutations
24829417 IL-36 promotes myeloid cell infiltration, activation, and inflammatory activity in skin
24717243 We report two cases of impetigo herpetiformis with homozygous and heterozygous IL36RN mutations.
24656634 Individuals with IL36RN mutations are very susceptible to Generalized pustular psoriasis (GPP) or GPP-related generalized pustulosis induced by drugs. [review]
23863864 The percentage of IL36RN mutations of pediatric generalized pustular psoriasis patients was much higher than that of adult onset patients.
23792462 IL36RN variants are unlikely to confer significant disease risk for psoriasis vulgaris.
23698098 The majority of generalized pustular psoriasis alone is caused by deficiency of the interleukin-36 receptor antagonist due to IL36RN mutations.
23648549 Our rate of 38.9% IL36RN mutations provides further evidence that generalized pustular psoriasis is heterogenous.
23428889 Acrodermatitis is a clinical phenotype of DITRA: evidence a variant of pustular psoriasis... recessively inherited mutations in the IL36RN gene, which encodes interleukin-36 receptor antagonist... the cause of familial GPP, a condition termed DITRA
23358093 IL36RN missense mutations may underlie some forms of acute generalized exanthematous pustulosis.
23303454 Rare pathogenic variants in IL36RN underlie a spectrum of psoriasis-associated pustular phenotypes.
22903787 Data indicate that IL36RN mutations were identified in 2 of 14 Japanese generalized pustular psoriasis (GPP) patients.
22862555 Results indicate that IL36RN mutations are not associated with pustular psoriasis in Chinese populations.
22325761 The mutation in the interleukin-36-receptor antagonist gene plays a role in generalised pustular psoriasis
22315422 These data provide evidence that IL-38 binds to the IL-36R, as does IL-36Ra.
21965679 Interleukin-36 (IL-36) ligands require processing for full agonist (IL-36alpha, IL-36beta, and IL-36gamma) or antagonist (IL-36Ra) activity
21839423 Mutations in IL36RN/IL1F5 are associated with the severe episodic inflammatory skin disease known as generalized pustular psoriasis.
21242515 Expression of IL-1F5 is increased in human plaque psoriasis skin and is overexpressed in the lesional psoriatic skin of transgenic mice.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20141484 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
18484691 Observational study of gene-disease association. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)
16978071 Data show that the gene expression for interleukin-8, IL-10, and IL-1Ra, but not IL-6, is increased in blood leukocytes taken from athletes following 2 hours of intensive cycling and is not influenced by carbohydrate compared with placebo ingestion.
16918024 Observational study of gene-disease association. (HuGE Navigator)
16211343 IL-1beta-511T was associated with reflux esophagitis having hyperacidity.
14644395 The commnon variants in the IL-1 cluster gene are not associated with incidence of restenosis in patients after PTCA.
11841485 results suggest that polymorphisms within IL1RN and IL1L1 themselves or a gene in linkage disequilibrium with IL1RN and IL1L1 predispose to the more severe forms of alopecia areata
11466363 IL-1 delta, which shows striking homology to IL-1 receptor antagonist, specifically and potently inhibits NF-kappa B activation through the orphan IL-1 receptor-related protein 2.

AA Sequence

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSC      1 - 70
GVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENG     71 - 140
GWNAPITDFYFQQCD                                                           141 - 155
//

Text Mined References (63)

PMID Year Title
26676204 2016 Integrative genomic analysis of interleukin-36RN and its prognostic value in cancer.
26589685 2016 Correlation of IL36RN mutation with different clinical features of pustular psoriasis in Chinese patients.
25989471 2015 Palmoplantar Pustular Psoriasis Is Associated with Missense Variants in CARD14, but Not with Loss-of-Function Mutations in IL36RN in European Patients.
25897967 2015 Transcriptional landscape of psoriasis identifies the involvement of IL36 and IL36RN.
25688670 2016 A novel mutation in IL36RN underpins childhood pustular dermatosis.
25615897 2015 IL36RN gene analysis of two Japanese patients with generalized pustular psoriasis.
25468355 2014 Novel IL36RN gene mutation revealed by analysis of 8 Japanese patients with generalized pustular psoriasis.
25458002 2015 IL36RN mutations define a severe autoinflammatory phenotype of generalized pustular psoriasis.
25416956 2014 A proteome-scale map of the human interactome network.
25212972 2014 Mutation analysis of the IL36RN gene in Chinese patients with generalized pustular psoriasis with/without psoriasis vulgaris.
24979538 Mutation analysis of IL36RN in a Chinese Daur family with generalized pustular psoriasis.
24829417 2014 IL-36 promotes myeloid cell infiltration, activation, and inflammatory activity in skin.
24717243 2014 IL36RN mutations underlie impetigo herpetiformis.
24656634 2014 The genetic background of generalized pustular psoriasis: IL36RN mutations and CARD14 gain-of-function variants.
23863864 2013 Prevalent and rare mutations in IL-36RN gene in Chinese patients with generalized pustular psoriasis and psoriasis vulgaris.
23792462 2014 Loss of IL36RN function does not confer susceptibility to psoriasis vulgaris.
23698098 2013 The majority of generalized pustular psoriasis without psoriasis vulgaris is caused by deficiency of interleukin-36 receptor antagonist.
23648549 2013 Mutations in IL36RN in patients with generalized pustular psoriasis.
23428889 2013 Acrodermatitis continua of Hallopeau is a clinical phenotype of DITRA: evidence that it is a variant of pustular psoriasis.
23358093 2013 Rare variations in IL36RN in severe adverse drug reactions manifesting as acute generalized exanthematous pustulosis.
23303454 2013 Rare pathogenic variants in IL36RN underlie a spectrum of psoriasis-associated pustular phenotypes.
23147407 2013 The IL-36 receptor pathway regulates Aspergillus fumigatus-induced Th1 and Th17 responses.
22903787 2013 Mutation analysis of the IL36RN gene in 14 Japanese patients with generalized pustular psoriasis.
22862555 2013 IL36RN gene mutations are not associated with sporadic generalized pustular psoriasis in Chinese patients.
22325761 2012 [Generalised pustular psoriasis: the role of mutation in the interleukin-36-receptor antagonist gene].
22315422 2012 IL-38 binds to the IL-36 receptor and has biological effects on immune cells similar to IL-36 receptor antagonist.
21965679 2011 Interleukin-36 (IL-36) ligands require processing for full agonist (IL-36?, IL-36?, and IL-36?) or antagonist (IL-36Ra) activity.
21848462 2011 Interleukin-36-receptor antagonist deficiency and generalized pustular psoriasis.
21839423 2011 Mutations in IL36RN/IL1F5 are associated with the severe episodic inflammatory skin disease known as generalized pustular psoriasis.
21242515 2011 IL-1F5, -F6, -F8, and -F9: a novel IL-1 family signaling system that is active in psoriasis and promotes keratinocyte antimicrobial peptide expression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20141484 2010 The interleukin-1 family gene polymorphisms in Korean patients with rheumatoid arthritis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
18484691 2008 Interleukin 1 polymorphisms in patients with ankylosing spondylitis in Korea.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
16978071 2006 Blood leukocyte mRNA expression for IL-10, IL-1Ra, and IL-8, but not IL-6, increases after exercise.
16918024 2006 Association between the interleukin-1 family gene cluster and psoriatic arthritis.
16211343 2005 Association between interleukin-1beta-511C/T polymorphism and reflux esophagitis in Japan.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14644395 2003 IL-1 cluster genes and occurrence of post-percutaneous transluminal coronary angioplasty restenosis: a prospective, angiography-based evaluation.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11991722 2002 A sequence-based map of the nine genes of the human interleukin-1 cluster.
11841485 2002 Genetic analysis of the interleukin-1 receptor antagonist and its homologue IL-1L1 in alopecia areata: strong severity association and possible gene interaction.
11574262 2001 A new nomenclature for IL-1-family genes.
11466363 2001 Two novel IL-1 family members, IL-1 delta and IL-1 epsilon, function as an antagonist and agonist of NF-kappa B activation through the orphan IL-1 receptor-related protein 2.
11278614 2001 Cloning and characterization of IL-1HY2, a novel interleukin-1 family member.
11145836 2001 IL-1H, an interleukin 1-related protein that binds IL-18 receptor/IL-1Rrp.
11093146 2000 A tissue specific IL-1 receptor antagonist homolog from the IL-1 cluster lacks IL-1, IL-1ra, IL-18 and IL-18 antagonist activities.
10866108 2000 Organization of the human interleukin-1 receptor antagonist gene IL1HY1.
10860666 2000 Identification and gene organization of three novel members of the IL-1 family on human chromosome 2.
10744718 2000 Identification and initial characterization of four novel members of the interleukin-1 family.
10625660 2000 Four new members expand the interleukin-1 superfamily.
10512743 1999 IL1HY1: A novel interleukin-1 receptor antagonist gene.
9169134 1997 Molecular cloning of the interleukin-1 gene cluster: construction of an integrated YAC/PAC contig and a partial transcriptional map in the region of chromosome 2q13.
8188271 1994 A physical map of the region encompassing the human interleukin-1 alpha, interleukin-1 beta, and interleukin-1 receptor antagonist genes.