Property Summary

NCBI Gene PubMed Count 69
PubMed Score 437.51
PubTator Score 62.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.900 3.6e-11

Gene RIF (48)

AA Sequence

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSC      1 - 70
GVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENG     71 - 140
GWNAPITDFYFQQCD                                                           141 - 155
//

Text Mined References (70)

PMID Year Title