Property Summary

NCBI Gene PubMed Count 69
PubMed Score 437.51
PubTator Score 62.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.900 3.6e-11

Synonym

Accession Q9UBH0 A8K2I4 Q56AT9 Q7RTZ6 IL-36Ra
Symbols FIL1
FIL1D
IL1F5
IL1L1
PSORP
IL1HY1
IL1RP3
IL36RA
IL-36Ra
PSORS14
FIL1(DELTA)

Gene

PDB

4P0J   4P0K   4P0L  

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (48)

AA Sequence

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSC      1 - 70
GVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENG     71 - 140
GWNAPITDFYFQQCD                                                           141 - 155
//

Text Mined References (70)

PMID Year Title