Property Summary

NCBI Gene PubMed Count 37
PubMed Score 8.05
PubTator Score 9.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
psoriasis 6685 3.808 1.9

Expression

  Differential Expression (7)

Disease log2 FC p
Barrett's esophagus 1.700 2.5e-02
psoriasis 5.600 0.0e+00
cutaneous lupus erythematosus 2.300 1.9e-03
tuberculosis -1.100 1.2e-03
non-small cell lung cancer 1.641 1.6e-05
cystic fibrosis 2.300 4.5e-04
spina bifida -1.884 2.3e-02

Gene RIF (24)

PMID Text
26819203 IRF6 is likely to promote inflammation to P. gingivalis through its regulation of IL-36gamma.
26562662 Findings indicate that Interleukin (IL)-1beta-induced interleukin 36 gamma (IL-36gamma) expression is mediated by the activation of transcriptional factors, NF-kappaB p65 and AP-1 (c-jun).
26516833 Study shows that plasma concentrations of IL-36alpha and IL-36gamma are overexpressed in active systemic lupus erythematosus patients and that IL-36alpha has a substantial pro-inflammatory effect through regulation of IL-6 and CXCL8 production.
26321222 IL-36gamma expression inversely correlated with the progression of human melanoma and lung cancer.
25897967 IL36G was identified as strong regulators of skin pathology in both lesional and non-lesional skin samples.
25525775 IL-36gamma is a valuable biomarker in psoriasis patients, both for diagnostic purposes and measurement of disease activity during the clinical course
25305315 CAMP induces IL-36gamma expression leading to initiation of skin inflammation and occasional exacerbations of psoriasis.
24950037 Decreased Langerhans cell responses to IL36G: altered innate immunity in patients with recurrent respiratory papillomatosis
24829417 IL-36 promotes myeloid cell infiltration, activation, and inflammatory activity in skin
23867815 HIV-1 gp120-treated vaginal epithelial cells show upregulation of interleukin 36, gamma (IL36G) expression as compared to untreated control
23383108 HIV-1 gp120-treated vaginal epithelial cells show upregulation of interleukin 36, gamma (IL36G) expression as compared to untreated control
23095752 Data presented herein shed further light on involvement of T-bet in innate immunity and suggest that IL-36gamma, besides IFNgamma, may contribute to functions of this transcription factor in immunopathology.
22318382 This is the first report of extracellular release of endogenous IL-36gamma through pyroptosis suggesting a function of IL-36gamma as an alarmin.
22082156 Knockdown of interleukin 36, gamma (IL36G) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
21965679 Interleukin-36 (IL-36) ligands require processing for full agonist (IL-36alpha, IL-36beta, and IL-36gamma) or antagonist (IL-36Ra) activity
21242515 Expression of IL-1F9 is increased in human plaque psoriasis skin and is overexpressed in a transgenic mouse psoriasis model.
20870894 Regulation and function of the IL-1 family cytokine IL-1F9 in human bronchial epithelial cells.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20141484 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of interleukin 36, gamma (IL36G) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
18484691 Observational study of gene-disease association. (HuGE Navigator)
15701729 This report demonstrates expression of IL1F9 by bronchial epithelial cells induced by pro-inflammatory stimuli, suggesting a function of this molecule in airway inflammation.
15331687 This is the first report of IL-1 genotype association with the inflammation of skeletal muscle following acute resistance exercise that may potentially affect the adaptations to chronic resistance exercise.
14734551 IL-1F6 and IL-1F8, in addition to IL-1F9, activate the pathway leading to NF-kappaB in an IL-1Rrp2-dependent manner in Jurkat cells

AA Sequence

MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQG      1 - 70
RGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFI     71 - 140
ASSKRDQPIILTSELGKSYNTAFELNIND                                             141 - 169
//

Text Mined References (38)

PMID Year Title
26819203 2016 IRF6 Regulates the Expression of IL-36? by Human Oral Epithelial Cells in Response to Porphyromonas gingivalis.
26562662 2015 Interleukin (IL)-1? Is a Strong Inducer of IL-36? Expression in Human Colonic Myofibroblasts.
26516833 2015 Elevated Expression and Pro-Inflammatory Activity of IL-36 in Patients with Systemic Lupus Erythematosus.
26321222 2015 IL-36? Transforms the Tumor Microenvironment and Promotes Type 1 Lymphocyte-Mediated Antitumor Immune Responses.
25897967 2015 Transcriptional landscape of psoriasis identifies the involvement of IL36 and IL36RN.
25525775 2015 IL-36? (IL-1F9) is a biomarker for psoriasis skin lesions.
25305315 2014 Alarmin function of cathelicidin antimicrobial peptide LL37 through IL-36? induction in human epidermal keratinocytes.
24950037 2014 Decreased Langerhans cell responses to IL-36?: altered innate immunity in patients with recurrent respiratory papillomatosis.
24829417 2014 IL-36 promotes myeloid cell infiltration, activation, and inflammatory activity in skin.
23147407 2013 The IL-36 receptor pathway regulates Aspergillus fumigatus-induced Th1 and Th17 responses.
23095752 2012 IL-36?/IL-1F9, an innate T-bet target in myeloid cells.
22318382 2012 The double-stranded RNA analogue polyinosinic-polycytidylic acid induces keratinocyte pyroptosis and release of IL-36?.
21965679 2011 Interleukin-36 (IL-36) ligands require processing for full agonist (IL-36?, IL-36?, and IL-36?) or antagonist (IL-36Ra) activity.
21242515 2011 IL-1F5, -F6, -F8, and -F9: a novel IL-1 family signaling system that is active in psoriasis and promotes keratinocyte antimicrobial peptide expression.
20870894 2011 Regulation and function of the IL-1 family cytokine IL-1F9 in human bronchial epithelial cells.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20141484 2010 The interleukin-1 family gene polymorphisms in Korean patients with rheumatoid arthritis.
18484691 2008 Interleukin 1 polymorphisms in patients with ankylosing spondylitis in Korea.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15701729 2005 Transcriptional response of bronchial epithelial cells to Pseudomonas aeruginosa: identification of early mediators of host defense.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15331687 2004 Interleukin-1 polymorphisms are associated with the inflammatory response in human muscle to acute resistance exercise.
14734551 2004 Interleukin (IL)-1F6, IL-1F8, and IL-1F9 signal through IL-1Rrp2 and IL-1RAcP to activate the pathway leading to NF-kappaB and MAPKs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11991723 2002 Genomic organization of the interleukin-1 locus.
11991722 2002 A sequence-based map of the nine genes of the human interleukin-1 cluster.
11574262 2001 A new nomenclature for IL-1-family genes.
11466363 2001 Two novel IL-1 family members, IL-1 delta and IL-1 epsilon, function as an antagonist and agonist of NF-kappa B activation through the orphan IL-1 receptor-related protein 2.
11278614 2001 Cloning and characterization of IL-1HY2, a novel interleukin-1 family member.
11145836 2001 IL-1H, an interleukin 1-related protein that binds IL-18 receptor/IL-1Rrp.
11093146 2000 A tissue specific IL-1 receptor antagonist homolog from the IL-1 cluster lacks IL-1, IL-1ra, IL-18 and IL-18 antagonist activities.
10860666 2000 Identification and gene organization of three novel members of the IL-1 family on human chromosome 2.
10744718 2000 Identification and initial characterization of four novel members of the interleukin-1 family.
10625660 2000 Four new members expand the interleukin-1 superfamily.
10512743 1999 IL1HY1: A novel interleukin-1 receptor antagonist gene.
9169134 1997 Molecular cloning of the interleukin-1 gene cluster: construction of an integrated YAC/PAC contig and a partial transcriptional map in the region of chromosome 2q13.
8188271 1994 A physical map of the region encompassing the human interleukin-1 alpha, interleukin-1 beta, and interleukin-1 receptor antagonist genes.