Property Summary

NCBI Gene PubMed Count 35
PubMed Score 7.40
PubTator Score 18.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1663 1.1e-03
esophageal adenocarcinoma 737 2.0e-02
Disease Target Count Z-score Confidence
Glanders 5 4.018 2.0
psoriasis 6685 3.58 1.8

Synonym

Accession Q9UHA7 B2RAD9 Q53SR7 Q5BLR4 Q7RTZ8
Symbols FIL1
FIL1E
IL1F6
IL-1F6
IL1(EPSILON)
FIL1(EPSILON)

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (20)

PMID Text
26752465 Increased Expression of Interleukin-36 is associated with Inflammatory Bowel Disease.
26560022 IL-36alpha acts as a pro-inflammatory cytokine at cartilage level, by increasing the expression of markers of inflammation and cartilage catabolism.
26516833 Study shows that plasma concentrations of IL-36alpha and IL-36gamma are overexpressed in active systemic lupus erythematosus patients and that IL-36alpha has a substantial pro-inflammatory effect through regulation of IL-6 and CXCL8 production.
25902739 IL36A-IL36R axis is modulated in patients with primary Sjogren's syndrome.
25700962 increases maturation of monocyte-derived dendritic cells
25550854 IL-36alpha was highly expressed in nearly half of all colorectal cancer patients. Low expression level of IL-36alpha correlated with larger tumor size and advanced cancer stage. Low expression of IL-36alpha resulted in a poor prognosis of colorectal cancer patients.
24829417 IL-36 promotes myeloid cell infiltration, activation, and inflammatory activity in skin
24061617 Results show that IL-36alpha expression may play a pivotal role in determining the prognosis of hepatocellular carcinoma (HCC).
23268368 The novel cytokine interleukin-36alpha is expressed in psoriatic and rheumatoid arthritis synovium.
21965679 Interleukin-36 (IL-36) ligands require processing for full agonist (IL-36alpha, IL-36beta, and IL-36gamma) or antagonist (IL-36Ra) activity
21242515 Expression of IL-1F6 is increased in human plaque psoriasis skin and in the lesional skin of transgenic mice compared with monotransgenic littermates.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20141484 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18484691 Observational study of gene-disease association. (HuGE Navigator)
17908936 Dysregulated expression in transgenic mice can promote cutaneous inflammation, revealing potential novel targets for the treatment of inflammatory skin disorders.
14734551 IL-1F6 and IL-1F8, in addition to IL-1F9, activate the pathway leading to NF-kappaB in an IL-1Rrp2-dependent manner in Jurkat cells
12110411 A functional IL-6 polymorphism has been weakly associated with level of peak bone mineral density and the rate of forearm trabecular postmenopausal bone loss in a cohort of women.
11466363 IL-1 epsilon, an interleukin-1 agonist, activates NF-kappa B through the orphan IL-1 receptor-related protein 2 and may constitute part of an independent signaling system present in human epithelial barriers.

AA Sequence

MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGL      1 - 70
NLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLIL     71 - 140
TQELGKANTTDFGLTMLF                                                        141 - 158
//

Text Mined References (37)

PMID Year Title
26752465 2016 Increased Expression of Interleukin-36, a Member of the Interleukin-1 Cytokine Family, in Inflammatory Bowel Disease.
26560022 2015 IL-36?: a novel cytokine involved in the catabolic and inflammatory response in chondrocytes.
26516833 2015 Elevated Expression and Pro-Inflammatory Activity of IL-36 in Patients with Systemic Lupus Erythematosus.
25902739 2015 Interleukin-36? axis is modulated in patients with primary Sjögren's syndrome.
25700962 2015 IL-36? induces maturation of Th1-inducing human MDDC and synergises with IFN-? to induce high surface expression of CD14 and CD11c.
25550854 2014 Decreased expression of interleukin-36? predicts poor prognosis in colorectal cancer patients.
24829417 2014 IL-36 promotes myeloid cell infiltration, activation, and inflammatory activity in skin.
24061617 2013 Decreased expression of interleukin-36? correlates with poor prognosis in hepatocellular carcinoma.
23268368 2013 The novel cytokine interleukin-36? is expressed in psoriatic and rheumatoid arthritis synovium.
21965679 2011 Interleukin-36 (IL-36) ligands require processing for full agonist (IL-36?, IL-36?, and IL-36?) or antagonist (IL-36Ra) activity.
21881584 2011 Inter-regulation of Th17 cytokines and the IL-36 cytokines in vitro and in vivo: implications in psoriasis pathogenesis.
21242515 2011 IL-1F5, -F6, -F8, and -F9: a novel IL-1 family signaling system that is active in psoriasis and promotes keratinocyte antimicrobial peptide expression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20141484 2010 The interleukin-1 family gene polymorphisms in Korean patients with rheumatoid arthritis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18484691 2008 Interleukin 1 polymorphisms in patients with ankylosing spondylitis in Korea.
17908936 2007 Opposing activities of two novel members of the IL-1 ligand family regulate skin inflammation.
16777052 2006 Nitroproteins from a human pituitary adenoma tissue discovered with a nitrotyrosine affinity column and tandem mass spectrometry.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14734551 2004 Interleukin (IL)-1F6, IL-1F8, and IL-1F9 signal through IL-1Rrp2 and IL-1RAcP to activate the pathway leading to NF-kappaB and MAPKs.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12110411 2002 Association between a functional interleukin-6 gene polymorphism and peak bone mineral density and postmenopausal bone loss in women: the OFELY study.
11991722 2002 A sequence-based map of the nine genes of the human interleukin-1 cluster.
11574262 2001 A new nomenclature for IL-1-family genes.
11466363 2001 Two novel IL-1 family members, IL-1 delta and IL-1 epsilon, function as an antagonist and agonist of NF-kappa B activation through the orphan IL-1 receptor-related protein 2.
11278614 2001 Cloning and characterization of IL-1HY2, a novel interleukin-1 family member.
11145836 2001 IL-1H, an interleukin 1-related protein that binds IL-18 receptor/IL-1Rrp.
11093146 2000 A tissue specific IL-1 receptor antagonist homolog from the IL-1 cluster lacks IL-1, IL-1ra, IL-18 and IL-18 antagonist activities.
10860666 2000 Identification and gene organization of three novel members of the IL-1 family on human chromosome 2.
10744718 2000 Identification and initial characterization of four novel members of the interleukin-1 family.
10625660 2000 Four new members expand the interleukin-1 superfamily.
10512743 1999 IL1HY1: A novel interleukin-1 receptor antagonist gene.
9169134 1997 Molecular cloning of the interleukin-1 gene cluster: construction of an integrated YAC/PAC contig and a partial transcriptional map in the region of chromosome 2q13.
8188271 1994 A physical map of the region encompassing the human interleukin-1 alpha, interleukin-1 beta, and interleukin-1 receptor antagonist genes.