Property Summary

NCBI Gene PubMed Count 129
PubMed Score 262.88
PubTator Score 58.21

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P24001 A6NNM0 A8MPX0 B4DJM1 B8Q191 D3DUB0 D3DUB2 Q5VFH7 Q5VFH8 Q8WV38 Q96GK9 IL-32
Symbols NK4
TAIF
TAIFa
TAIFb
TAIFc
TAIFd
IL-32beta
IL-32alpha
IL-32delta
IL-32gamma

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (123)

PMID Text
26678222 This study demonstrates that IL-32gamma and IL-32beta can induce caspase-8-dependent cell death whereas this was not observed for IL-32alpha
26634249 Additional IL-32gamma stimulation in precursor cells enhanced osteoblast differentiation potentially
26551670 High IL32 expression is associated with Sezary syndrome.
26516703 High IL32 expression is associated with acute myeloid leukemia.
26241657 Our results suggest that NKP30-B7-H6 interaction can aggravate hepatocyte damage, probably through up-regulation of IL-32 expression in hepatitis B virus-related acute-on-chronic liver failure
26151454 IL-32 is involved in the pathogenesis of airway inflammation.
26144292 highlight some of the potential mechanisms by which the immunomodulatory effect of IL-32 occurs against mycobacterial infections but also areas where mechanistic clarifications are needed
26057774 data further confirms that reduced IL32 methylation is associated with JIA, and that SNPs play an interactive role
25909160 In IL-32alpha-Tg mice, azoxymethane-induced colon cancer incidence was decreased, but expression of TNFR1 and TNFR1-mediated apoptosis was increased. IL-32alpha increased ROS production, prolonging JNK activation. In colon cancer patients, IL-32alpha was increased.
25889282 High IL-32 expression may stimulate the organic metastasis and the lymph node metastasis of colorectal cancer.
25887904 The anti-Mycobacterium tuberculosis effects of IL-32gamma are mediated through classical caspase-3-dependent apoptosis as well as caspase-3-independent apoptosis.
25846944 IL-32 stimulation promotes the invasion and motility of osteosarcoma cells, possibly via the activation of AKT and the upregulation of MMP-13 expression.
25820174 IL-32gamma enhances host immunity to Mycobacterium tuberculosis.
25810549 The Epstein-Barr virus LMP1-induced IL-32 traps protein kinase Cdelta in the cytoplasm and prevents it from binding to the Zta promoter, which is the key event for virus activation.
25754842 Data show that toll-like receptor 3/TRIF protein signalling regulates cytokines IL-32 and IFN-beta secretion by activation of receptor-interacting protein-1 (RIP-1) and tumour necrosis factor receptor-associated factor 6 (TRAF6) in cornea epithelial cells.
25726525 we demonstrate that the newly discovered isoform, IL-32theta;, suppresses monocyte differentiation by regulating the expression of the PU.1 transcription factor.
25663496 This study demonstrates that IL-32 gene polymorphisms are significantly associated with increased endometrial cancer susceptibility in Chinese Han women
25645248 Transgenic mice that express human interleukin-32 are protected from high-fat diet-induced hepatic steatosis.
25583360 IL-32gamma prevents ethanol-induced hepatic injury via the inhibition of oxidative damage and inflammatory responses.
25280942 IL-32theta;, through its interaction with PKCdelta, downregulates CCL5 expression by mediating the phosphorylation of STAT3 on Ser727 to render it transcriptionally inactive.
25275312 IL-32 gamma delays, in a dose-dependent manner, the spontaneous apoptosis of human blood neutrophils by activating mainly p38 MAPK through rapid p38 phosphorylation.
25245533 IL-32alpha inhibits BCL6 SUMOylation by activating PKCepsilon, resulting in the modulation of BCL6 target genes and cellular functions of BCL6.
25178676 Data suggest that interleukin-32alpha (IL-32alpha) associates with leukemia zinc finger (PLZF) and protein kinase c epsilon (PKCvarepsilon), and then inhibits PLZF sumoylation, resulting in suppression of the transcriptional activity of PLZF.
25176527 soluble IL-6R expression upregulated the levels of its own ligand, IL-6 and those of the pro-inflammatory cytokine IL-32.
25159479 These results suggest that IL-32beta could activate NF-kappaB and STAT3, and thus affect neuroinflammation as well as amyloidogenesis, leading to worsening memory impairment.
25143364 These results identify IL-32 as one functional marker and potential correlate of protection against active tuberculosis.
25100201 Analysis of several GEO datasets showed differential expression of IL32 in patient samples previously designated as basal and/or triple negative breast cancer compared to normal and luminal breast samples.
25022955 overexpression of IL-32gamma contributes to initial islet beta-cells injury and inflammation in pancreas and aggravates streptozotocin-induced type 1 diabetes.
24996056 IL-32theta; reduces PKCdelta-mediated phosphorylation of PU.1, resulting in attenuation of IL-1beta production
24938282 IL32 may play a unique role in mycosis fungoides progression as an autocrine cytokine
24884781 major role in the inflammatory process caused by Leishmania (Viannia) spp.
24879659 Although more studies are required, the pathogenic roles of IL-32 in some lupus nephritis patients could be supposed
24874739 IL-32-treated M2-macrophages inhibit the strong activation of p38, IKK alpha/beta, and TAK1 by HIV-1 Nef
24854197 IL-32alpha can prevent cerebral ischemia damage via STAT3 activation and inhibition of NF-kappaB activation.
24748497 The findings of this study regarding the unique functional interplay between M-CSF and IL-32 increase our understanding of the mechanisms that regulate the survival and M1/M2 ratio of macrophages, as well as HIV-1 replication in macrophages.
24743568 These results suggest that IL-32gamma enhances an innate immune response against local infection but inhibits the spread of immune responses, leading to systemic immune disorder.
24703937 IL-32alpha-mediated STAT3 S727 phosphorylation induced C/EBPalpha association, which inhibited PU.1 expression, and then resulted in the down-regulation of CD18 expression.
24602839 Our results clearly suggest that IL-32 is an important mediator for gastric cancer metastasis and independent prognostic predictor of gastric cancer.
24579465 Serum IL-32 expression level was increased in patients with HBV-related liver failure and was associated with the severity of inflammation.
24553842 These studies disclosed that antiviral IFN-induced MxA and APOBEC3G/3F mRNA levels were increased after IL-32gamma treatment of peripheral blood mononuclear cells.
24472437 IL-32 may have diverse intracellular effects through the interactions with its different isoforms.
24396867 IL-32delta interacts with IL-32beta and down-regulates IL-10 expression.
24337385 VEGF-independent to the portfolio of IL-32.
24295830 bacterial infection-mediated activation of NOD1,2, together with IL-32gamma, can synergize the activation of eosinophils interacting with bronchial epithelial cells.
24226419 Our results suggest that IL-32 has a role in the formation and maintenance of cutaneous T-cell lymphoma lesions.
24140068 These studies demonstrate that IL-32 plays a role in the tumor-associated inflammatory microenvironment and that overexpression of IL-32 contributes to invasion and metastasis in primary lung adenocarcinoma.
24129891 IL-32-PAR2 axis is an innate immunity sensor providing alternative signaling for LPS-TRIF axis.
24114327 Data indicate that the IL-32beta-VEGF-STAT3 pathway affects the migration of MDA-MB-231 cells.
23814099 IL-32beta-mediated C/EBPalpha Ser-21 phosphorylation by PKCdelta suppressed C/EBPalpha binding to IL-10 promoter, which promoted IL-10 production in U937 cells.
23729669 IL-32 levels during viral infection mediate antiviral effects by stimulating the expression of IFN-lambda1.
23727326 IL-32 acts as a proinflammatory factor and may be implicated in the inflammatory cascade contributing to atherosclerosis.
23703385 IL-32beta inhibits tumor growth by increasing cytotoxic lymphocyte numbers, and by inactivating the NF-kappaB and STAT3 pathways through changing of cytokine levels in tumor tissues.
23607494 involved the pathogenesis of cholangitis in biliary atresia
23567618 Tumor necrosis factor (TNF)-alpha, interferon (IFN)-gamma and IL-1beta significantly increased both IL-33 protein and IL-33 mRNA expression in HACF and HACM as well as in human coronary artery smooth muscle cells (HCASMC).
23534905 These findings demonstrate that IL-32 is induced by microbial ligands through TLR-mediated innate signaling pathways, suggesting an important role of corneal epithelium in inflammatory disease.
23517397 The levels of IL-32 and TNF-alpha in the peripheral blood of patients with active RA are significantly higher than in that of patients with stable RA and healthy people.
23486016 An association of a germ-line polymorphism in the promoter of the IL32 gene with increased thyroid cancer susceptibility is observed.
23479179 Tumor invasion in gastric cancer is more severe in the IL-32 positive expression group than in cancer cells lacking IL-32.
23402302 IL-32 expression was induced by active human cytomegalovirus infection and could be functionally down-regulated by ectopically expressed human cytomegalovirus-miR-UL112-1.
23359495 Overexpression of IL32 is associated with head and neck squamous cell carcinoma.
23180362 plasma IL-32alpha levels are associated with inflammatory responses in NMO patients.
23148681 Data indicate that CD4+ T cells and fibroblast-like synoviocytes (FLSs) interact with each other by direct contact and cytokine secretion, and amplifies the expression of IL-17 and IL-32.
22927445 the intracellular interaction of IL-32alpha with PKCepsilon and STAT3 promotes STAT3 binding to the IL-6 promoter by enforcing STAT3 phosphorylation, which results in increased production of IL-6.
22687868 These results suggest that IL-32 could be implicated in chronic hepatitis B-related liver inflammation/fibrosis.
22613074 These results show that IL-32alpha contributed to the development of inflammatory arthritis and endotoxin lethality.
22563781 IL-10, IL-17, IL-32 and TGF-beta- producing regulatory B cells.
22486709 these data demonstrated a potential role for IL-32 in the pathogenesis of chronic rhinosinusitis
22277801 The present results suggest that IL-32gamma expression and its genetic variation in individual could be an important aspect of viral infections.
22203669 IL-32 binds to the extracellular domain of integrins and to intracellular proteins like paxillin and FAK
22198481 suggest that IL-32alpha is involved in the progression of hepatocellular carcinoma and may be a useful biomarker for diagnosis and therapeutic target of hepatocellular carcinoma
22043900 It was shown that IL-32 enhanced the cytotoxic effect of natural killer cells on protate cancer cells through activation of DR3 and caspase-3.
22037460 these data suggest that IL-8 and IL-32 play a role in regulating the cancer stem cell -like properties that promote tumorigenesis of colorectal cancer cells in both autocrine and paracrine manners.
21899560 Overproduction of IL-32 may be involved in the pathogenesis of chronic rhinosinusitis
21725974 Transcriptional profiling of ATRA-treated SCC-9 cells showed downregulation of IL-32, which has been implicated in metastasis in a variety of tumors.
21649914 A common IL-32 genotype, rs12934561, is associated with the risk of Acute Lung Injury (ALI) as well as the need for prolonged mechanical ventilatory support.
21602493 hypothesize that p300 and DAPK-1 represent nodes where the inflammatory networks of IL-32 and IL-17 overlap, and that these proteins would affect both TNF-R1-dependent and -independent pathways
21551364 IL-32gamma could effectively induce the maturation and activation of immature dendritic cells (DC), leading to enhanced Th1 and Th17 responses as the result of increased IL-12 and IL-6 production in DCs.
21525393 Data suggest that IL-32 moderates chronic immune activation to avert associated immunopathology but at the same time dampens the antiviral immune response and thus paradoxically supports HIV-1 replication and viral persistence.
21487807 This study suggests the possibility that IL-32 might contribute to myasthenia gravis pathogenesis or immunoregulation
21481941 in conclusion, IL-32 is induced by HBx in Huh7 cells; results suggest that IL-32 might play an important role in inflammatory response after HBV infection
21469100 promotes hematopoietic progenitor expansion
21468596 Stable transfection of the new IL-32 isoform significantly decreased TNF-alpha-induced IL-8 mRNA expression in HT-29 cells.
21452292 Our findings indicate that overexpression of IL-32 together with a clear Th1 response immunologically characterizes the inflammatory response in giant cell arteritis. In particular, IL-32 seems to be an important mediator of artery inflammation in GCA.
21423208 significant pathophysiological roles of IL-32gamma
21383200 naturally occurring IL-32gamma can be spliced into IL-32beta, which is a less potent proinflammatory mediator. Splicing of IL-32gamma into IL-32beta is a safety switch in controlling the effects of IL-32gamma and thereby reduces chronic inflammation.
21346229 A central role is discovered for IL-32 in the immune response to vesicular stomatitis Indiana virus (an RNA virus) and DNA virus human herpesvirus type 2.
21321117 Data show that IL-32alpha stimulates Fas and ULBP2 expression via activation of p38 MAPK, which increases NK susceptibility of chronic myeloid leukemia cells.
21208204 the high-risk variant of human papillomavirus induces IL-32 expression
21152864 IL-32alpha mRNA expression depends on the phosphatidylinositol 3-kinase and the NF-kappaB system
21078994 the role of IL-32 in intestinal inflammation
20926308 Demonstration of membrane association for both intracellular and released IL-32 suggests this unique cytokine may have a complex biosynthetic pathway and mechanism of action.
20889550 We have demonstrated the anti-influenza virus function of IL-32
20888796 The results from the present study suggest that IL-32 may play a role in the regulation of neuroinflammatory responses in several neurological disease conditions such as ischemia and Alzheimer's disease.
20615213 IL-32 synthesis by fibroblast-like synoviocytes is tightly regulated by innate immunity in rheumatoid arthritis
20541181 human IL-32alpha and IL-32beta regulates on xenograft rejection in cellular xenotransplantation
20480520 Butyrate stimulated IL-32alpha expression in epithelial cell lines. An epigenetic mechanism, such as histone hyperacetylation, might be involved in the action of butyrate on IL-32alpha expression.
20470879 The results showed that Orientia tsutsugamushi infection activated the NOD1 pathway followed by IL-32 secretion, thus resulting in the production and expression of IL-1beta, IL-6, IL-8, and ICAM-1 endothelial cells.
20400971 These results show that genetic modification of DU145 cells with NK4 cDNA yields a significant effect on their proliferation, migration, invasion and apoptosis.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20227751 The present study demonstrates keratinocytes (KCs) as a source of IL-32, which modulates KC apoptosis and contributes to the pathophysiology of atopic dermatitis.
20221440 IL-32 has an important role in vascular inflammation and sepsis development
20190143 IL-32 plays a host defense role against M. tuberculosis in differentiated THP-1 human macrophages.
20112365 IL-32gamma is a potent mediator of active osteoclast generation in the presence of sRANKL
19880327 These data suggest that IL-32, which induces IL-1beta, IL-6, and chemokines, is not only involved in host defense against pathogens, but also might play a role in chronic inflammatory diseases.
19740314 IL-32beta upregulates the production of an anti-inflammatory cytokine IL-10, and then IL-10 suppresses proinflammatory cytokines.
19628777 IL-32 was differentially expressed by lung cancer histotypes;with strong expression in most adenocarcinomas (AC) and their precursors, as well large-cell carcinomas and small-cell lung cancers; lacking in squamous cell carcinoma
19386602 High IL-32 is associated with Pancreatic Cancer.
19364659 Data show that the IL-32 gene is expressed in human endothelial cells and Akt strongly induces its expression.
19291698 Influenza A virus infection activates IL-32 and iNOS expression by a heretofore unrecognized complex mechanism, in which the two pro-inflammatory factors regulate each other, involving positive and negative feedback regulatory loops.
19248119 IL-32 may be a newly identified prognostic biomarker in rheumatoid arthritis. Production of IL-32 in rheumatoid synovial fibroblasts is regulated by Syk/PKCdelta/JNK-mediated signaling events.
19228941 This study introduces IL-32 as a critical regulator of endothelial function, expanding the properties of this cytokine relevant to coagulation, endothelial inflammation, and atherosclerosis.
19017495 The N-terminal IL-32 isoform gamma separate domain evidenced the highest levels of biological activity among the IL-32 separate domains.
18768856 Constitutive expression of IL-32 in an immature monocyte-derived dendritic cell subset may be related to the potency of expressed Venezuelan equine encephalitis (VEE) particle vector system as well as potentially to the pathogenesis of VEE.
18414668 the interleukin-32 pro-inflammatory pathway is activated in response to influenza A virus infectio
18296636 induction of TNF, IL-1beta, and IL-6 by IL-32 is mediated by p38-MAPK; IL-32-induced monocyte-to-macrophage differentiation is mediated through nonapoptotic, caspase-3-dependent mechanisms
18289868 Data suggest that the constitutive expression of IL-32 mRNA as well as the predominant production of a smaller sized IL-32 isoform in Jurkat cells may implicate a role for IL-32 in human T cell leukemia.
18287021 Dysregulation of IL-32 in myelodysplastic syndrome and chronic myelomonocytic leukemia modulates apoptosis and impairs NK function.
17619821 review of important role of IL32 in the pathogenesis of rheumatoid arthritis
16903774 IL-32 is a cell-associated proinflammatory cytokine, which is specifically stimulated by mycobacteria through a caspase-1- and IL-18-dependent production of interferon gamma.
16492735 IL-32, strongly associated with TNFalpha, IL-1beta, and IL-18, appears to play a role in human rheumatoid arthritis and may be a novel target in autoimmune diseases.
16488976 Proteinase 3 is a specific IL-32alpha binding protein, independent of its enzymatic activity
16410314 results strongly indicate that IL-32 is involved in activation-induced cell death in T cells, probably via its intracellular actions
16303761 A potential physiological pathway for inactivation of HGF and generation of NK4-like antagonists.

AA Sequence

MCFPKVLSDDMKKLKARMVMLLPTSAQGLGAWVSACDTEDTVGHLGPWRDKDPALWCQLCLSSQHQAIER      1 - 70
FYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVED     71 - 140
PATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQ    141 - 210
SYGAPRGDKEELTPQKCSEPQSSK                                                  211 - 234
//

Text Mined References (131)

PMID Year Title
26678222 2016 Alternatively spliced isoforms of IL-32 differentially influence cell death pathways in cancer cell lines.
26634249 2015 High level of interleukin-32 gamma in the joint of ankylosing spondylitis is associated with osteoblast differentiation.
26551670 2015 Genomic profiling of Sézary syndrome identifies alterations of key T cell signaling and differentiation genes.
26516703 2015 IL-32? gene expression in acute myeloid leukemia suppresses TNF-? production.
26241657 2015 NKP30-B7-H6 Interaction Aggravates Hepatocyte Damage through Up-Regulation of Interleukin-32 Expression in Hepatitis B Virus-Related Acute-On-Chronic Liver Failure.
26151454 2015 Synthetic double-stranded RNA induces interleukin-32 in bronchial epithelial cells.
26144292 2015 The role of interleukin-32 against tuberculosis.
26057774 2015 DNA methylation at IL32 in juvenile idiopathic arthritis.
25909160 2015 IL-32? suppresses colorectal cancer development via TNFR1-mediated death signaling.
25889282 2015 Dysregulation of over-expressed IL-32 in colorectal cancer induces metastasis.
25887904 2015 Caspase-3-independent apoptotic pathways contribute to interleukin-32?-mediated control of Mycobacterium tuberculosis infection in THP-1 cells.
25846944 2015 Interleukin-32 stimulates osteosarcoma cell invasion and motility via AKT pathway-mediated MMP-13 expression.
25820174 2015 Human IL-32 expression protects mice against a hypervirulent strain of Mycobacterium tuberculosis.
25810549 2015 Maintenance of Epstein-Barr Virus Latent Status by a Novel Mechanism, Latent Membrane Protein 1-Induced Interleukin-32, via the Protein Kinase C? Pathway.
25754842 2015 TLR3/TRIF signalling pathway regulates IL-32 and IFN-? secretion through activation of RIP-1 and TRAF in the human cornea.
25726525 2015 IL-32? inhibits monocytic differentiation of leukemia cells by attenuating expression of transcription factor PU.1.
25663496 2015 Significant association between IL-32 gene polymorphisms and susceptibility to endometrial cancer in Chinese Han women.
25645248 2015 Interleukin-32? ameliorates metabolic disorder and liver damage in mice fed high-fat diet.
25583360 2015 Interleukin-32? attenuates ethanol-induced liver injury by the inhibition of cytochrome P450 2E1 expression and inflammatory responses.
25280942 2014 IL-32? downregulates CCL5 expression through its interaction with PKC? and STAT3.
25275312 2014 IL-32? delays spontaneous apoptosis of human neutrophils through MCL-1, regulated primarily by the p38 MAPK pathway.
25245533 2014 Interleukin-32? downregulates the activity of the B-cell CLL/lymphoma 6 protein by inhibiting protein kinase C?-dependent SUMO-2 modification.
25178676 2014 Interleukin-32? modulates promyelocytic leukemia zinc finger gene activity by inhibiting protein kinase C?-dependent sumoylation.
25176527 2015 Soluble interleukin-6 receptor is elevated during influenza A virus infection and mediates the IL-6 and IL-32 inflammatory cytokine burst.
25159479 2015 Neuroinflammatory and Amyloidogenic Activities of IL-32? in Alzheimer's Disease.
25143364 2014 IL-32 is a molecular marker of a host defense network in human tuberculosis.
25100201 2014 Preliminary characterization of IL32 in basal-like/triple negative compared to other types of breast cell lines and tissues.
25022955 2014 IL-32? overexpression accelerates streptozotocin (STZ)-induced type 1 diabetes.
24996056 2014 IL-32? negatively regulates IL-1? production through its interaction with PKC? and the inhibition of PU.1 phosphorylation.
24938282 2014 IL32 is progressively expressed in mycosis fungoides independent of helper T-cell 2 and helper T-cell 9 polarization.
24884781 2014 Interleukin 32? (IL-32?) is highly expressed in cutaneous and mucosal lesions of American Tegumentary Leishmaniasis patients: association with tumor necrosis factor (TNF) and IL-10.
24879659 2014 Three cases of lupus nephritis patients with serum interleukin-32? detection.
24854197 2015 Reducing effect of IL-32? in the development of stroke through blocking of NF-?B, but enhancement of STAT3 pathways.
24748497 2014 M-CSF inhibits anti-HIV-1 activity of IL-32, but they enhance M2-like phenotypes of macrophages.
24743568 2014 Interleukin-32? transgenic mice resist LPS-mediated septic shock.
24703937 2014 IL-32? down-regulates ?2 integrin (CD18) expression by suppressing PU.1 expression in myeloid cells.
24602839 2014 Interleukin-32 increases human gastric cancer cell invasion associated with tumor progression and metastasis.
24579465 2013 [Interleukin-32 expression in serum of patients with HBV-related liver failure and its significance].
24553842 2014 Interleukin-32 isoforms: expression, interaction with interferon-regulated genes and clinical significance in chronically HIV-1-infected patients.
24472437 2014 Interaction network mapping among IL-32 isoforms.
24396867 2013 Interleukin-32? interacts with IL-32? and inhibits IL-32?-mediated IL-10 production.
24337385 2014 IL-32 promotes angiogenesis.
24295830 2014 Molecular mechanisms regulating the synergism between IL-32? and NOD for the activation of eosinophils.
24226419 2014 The role of IL-32 in cutaneous T-cell lymphoma.
24140068 2014 Interleukin-32 contributes to invasion and metastasis of primary lung adenocarcinoma via NF-kappaB induced matrix metalloproteinases 2 and 9 expression.
24129891 2013 IL-32-PAR2 axis is an innate immunity sensor providing alternative signaling for LPS-TRIF axis.
24114327 2013 Interleukin-32? stimulates migration of MDA-MB-231 and MCF-7cells via the VEGF-STAT3 signaling pathway.
23814099 2013 Interleukin (IL)-32?-mediated CCAAT/enhancer-binding protein ? (C/EBP?) phosphorylation by protein kinase C? (PKC?) abrogates the inhibitory effect of C/EBP? on IL-10 production.
23729669 2013 Inducible interleukin 32 (IL-32) exerts extensive antiviral function via selective stimulation of interferon ?1 (IFN-?1).
23727326 2013 Towards a role of interleukin-32 in atherosclerosis.
23703385 2013 Antitumor activity of IL-32? through the activation of lymphocytes, and the inactivation of NF-?B and STAT3 signals.
23607494 2013 Interleukin-32 production associated with biliary innate immunity and proinflammatory cytokines contributes to the pathogenesis of cholangitis in biliary atresia.
23567618 2013 Components of the interleukin-33/ST2 system are differentially expressed and regulated in human cardiac cells and in cells of the cardiac vasculature.
23534905 2013 TLR-mediated induction of proinflammatory cytokine IL-32 in corneal epithelium.
23517397 2013 Clinical significance of interleukin-32 expression in patients with rheumatoid arthritis.
23486016 2013 A promoter polymorphism in human interleukin-32 modulates its expression and influences the risk and the outcome of epithelial cell-derived thyroid carcinoma.
23479179 2013 IL-32 expression is an independent prognostic marker for gastric cancer.
23402302 2013 The expression of interleukin-32 is activated by human cytomegalovirus infection and down regulated by hcmv-miR-UL112-1.
23359495 2014 Interleukin-32 expression is associated with a poorer prognosis in head and neck squamous cell carcinoma.
23180362 2013 Increased plasma interleukin-32 expression in patients with neuromyelitis optica.
23148681 2012 IL-32 and IL-17 interact and have the potential to aggravate osteoclastogenesis in rheumatoid arthritis.
22927445 2012 Intracellular interaction of interleukin (IL)-32? with protein kinase C? (PKC? ) and STAT3 protein augments IL-6 production in THP-1 promonocytic cells.
22687868 2012 Increased interleukin-32 expression in chronic hepatitis B virus-infected liver.
22613074 2012 Enhanced susceptibility to lipopolysaccharide-induced arthritis and endotoxin shock in interleukin-32 alpha transgenic mice through induction of tumor necrosis factor alpha.
22563781 2012 Allergen-specific responses of CD19(high) and CD19(low) B Cells in Non-IgE-mediated food allergy of late eczematous reactions in atopic dermatitis: presence of IL-17- and IL-32-producing regulatory B cells (Br17 & Br32).
22486709 2012 Regulation and expression of IL-32 in chronic rhinosinusitis.
22277801 2012 Characterizing antiviral mechanism of interleukin-32 and a circulating soluble isoform in viral infection.
22203669 2012 Interleukin 32 (IL-32) contains a typical ?-helix bundle structure that resembles focal adhesion targeting region of focal adhesion kinase-1.
22198481 2012 Dysregulation of overexpressed IL-32? in hepatocellular carcinoma suppresses cell growth and induces apoptosis through inactivation of NF-?B and Bcl-2.
22174851 2011 Genomewide association study for determinants of HIV-1 acquisition and viral set point in HIV-1 serodiscordant couples with quantified virus exposure.
22043900 2012 Interleukin-32 enhances cytotoxic effect of natural killer cells to cancer cells via activation of death receptor 3.
22037460 2011 Oct4-related cytokine effects regulate tumorigenic properties of colorectal cancer cells.
21899560 2012 Differential expression of interleukin-32 in chronic rhinosinusitis with and without nasal polyps.
21725974 2011 Genome-wide transcriptional profiling analysis of all trans retinoic acid-treated tongue carcinoma SCC-9 cells.
21649914 2011 Association between IL-32 genotypes and outcome in infection-associated acute lung injury.
21602493 2011 Inflammatory cytokines IL-32 and IL-17 have common signaling intermediates despite differential dependence on TNF-receptor 1.
21551364 2011 IL-32gamma induces the maturation of dendritic cells with Th1- and Th17-polarizing ability through enhanced IL-12 and IL-6 production.
21525393 2011 The immunosuppressive role of IL-32 in lymphatic tissue during HIV-1 infection.
21487807 2011 Elevated serum level of interleukin-32? in the patients with myasthenia gravis.
21481941 2011 Interleukin-32 expression induced by hepatitis B virus protein X is mediated through activation of NF-?B.
21469100 2011 Interleukin 32 promotes hematopoietic progenitor expansion and attenuates bone marrow cytotoxicity.
21468596 A new isoform of interleukin-32 suppresses IL-8 mRNA expression in the intestinal epithelial cell line HT-29.
21452292 2011 Expression of interleukin-32 in the inflamed arteries of patients with giant cell arteritis.
21423208 2011 IL-32? inhibits cancer cell growth through inactivation of NF-?B and STAT3 signals.
21383200 2011 Inflammation-dependent secretion and splicing of IL-32{gamma} in rheumatoid arthritis.
21346229 2011 Protection from RNA and DNA viruses by IL-32.
21321117 2011 Overexpression of IL-32alpha increases natural killer cell-mediated killing through up-regulation of Fas and UL16-binding protein 2 (ULBP2) expression in human chronic myeloid leukemia cells.
21208204 2011 Activation of the interleukin-32 pro-inflammatory pathway in response to human papillomavirus infection and over-expression of interleukin-32 controls the expression of the human papillomavirus oncogene.
21152864 2011 Interleukin-32? expression in human colonic subepithelial myofibroblasts.
21078994 2010 Paradoxical effects of constitutive human IL-32{gamma} in transgenic mice during experimental colitis.
20926308 2011 Native IL-32 is released from intestinal epithelial cells via a non-classical secretory pathway as a membrane-associated protein.
20889550 2010 IL-32: a host proinflammatory factor against influenza viral replication is upregulated by aberrant epigenetic modifications during influenza A virus infection.
20888796 2010 The effects of IL-32 on the inflammatory activation of cultured rat primary astrocytes.
20615213 2010 Innate immunity triggers IL-32 expression by fibroblast-like synoviocytes in rheumatoid arthritis.
20541181 2010 Downregulation of immune response by the human cytokines Interleukin-32alpha and beta in cell-mediated rejection.
20480520 2010 Butyrate stimulates IL-32alpha expression in human intestinal epithelial cell lines.
20470879 2010 Orientia tsutsugamushi induced endothelial cell activation via the NOD1-IL-32 pathway.
20400971 2010 Effects of transferred NK4 gene on proliferation, migration, invasion and apoptosis of human prostate cancer DU145 cells.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20227751 2010 IL-32 is expressed by human primary keratinocytes and modulates keratinocyte apoptosis in atopic dermatitis.
20221440 2010 Interleukin-32beta propagates vascular inflammation and exacerbates sepsis in a mouse model.
20190143 2010 IL-32 is a host protective cytokine against Mycobacterium tuberculosis in differentiated THP-1 human macrophages.
20112365 2010 Effect of interleukin-32gamma on differentiation of osteoclasts from CD14+ monocytes.
19946888 2010 Defining the membrane proteome of NK cells.
19880327 2010 Suppressing IL-32 in monocytes impairs the induction of the proinflammatory cytokines TNFalpha and IL-1beta.
19740314 2009 A proinflammatory cytokine interleukin-32beta promotes the production of an anti-inflammatory cytokine interleukin-10.
19628777 2009 Expression of IL-32 in human lung cancer is related to the histotype and metastatic phenotype.
19386602 2009 Interleukin-32 expression in the pancreas.
19364659 2009 Molecular characterization of IL-32 in human endothelial cells.
19291698 2009 Negative feedback regulation of IL-32 production by iNOS activation in response to dsRNA or influenza virus infection.
19248119 2009 Tumor necrosis factor alpha-induced interleukin-32 is positively regulated via the Syk/protein kinase Cdelta/JNK pathway in rheumatoid synovial fibroblasts.
19228941 2009 IL-32-dependent effects of IL-1beta on endothelial cell functions.
19017495 2008 Proteinase 3-processed form of the recombinant IL-32 separate domain.
18768856 2008 A human dendritic cell subset receptive to the Venezuelan equine encephalitis virus-derived replicon particle constitutively expresses IL-32.
18414668 2008 Activation of interleukin-32 pro-inflammatory pathway in response to influenza A virus infection.
18296636 2008 Interleukin-32 induces the differentiation of monocytes into macrophage-like cells.
18289868 2008 Unique expression of a small IL-32 protein in the Jurkat leukemic T cell line.
18287021 2008 Dysregulation of IL-32 in myelodysplastic syndrome and chronic myelomonocytic leukemia modulates apoptosis and impairs NK function.
17619821 2007 Rheumatoid arthritis and interleukin-32.
16903774 2006 Mycobacterium tuberculosis induces interleukin-32 production through a caspase- 1/IL-18/interferon-gamma-dependent mechanism.
16492735 2006 IL-32, a proinflammatory cytokine in rheumatoid arthritis.
16488976 2006 Proteinase 3 is an IL-32 binding protein.
16410314 2006 Involvement of IL-32 in activation-induced cell death in T cells.
16341674 2005 Transcriptome analysis of human gastric cancer.
15664165 2005 Interleukin-32: a cytokine and inducer of TNFalpha.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9653642 1998 A transcriptional Map of the FMF region.
1729377 1992 Identification of a novel gene expressed in activated natural killer cells and T cells.