Property Summary

NCBI Gene PubMed Count 23
PubMed Score 695.83
PubTator Score 296.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
tuberculosis and treatment for 3 months -1.300 4.1e-04
psoriasis -1.200 9.3e-23

 IMPC Phenotype (1)

Gene RIF (15)

PMID Text
25283844 The interleukin IL-31/IL-31receptor axis contributes to tumor growth in human follicular lymphoma.
24667097 detected in keratinocytes and nerve fibers in the dermis of atopic dermatitis and in the neurons of normal dorsal root ganglia
24373353 IL31RA is a functional receptor expressed by a small subpopulation of IL-31RA(+)/TRPV1(+)/TRPA1(+) neurons and is a critical neuroimmune link between TH2 cells and sensory nerves for the generation of T cell-mediated itch.
23392388 IL-31 and IL-31RA are upregulated in patients with allergic rhinitis, and induce MUC5AC gene expression in human airway epithelial cells.
23333304 HIV-1 Vif modulates the expression of interleukin 31 receptor A (IL31RA) in Vif-expression T cells
20849534 IFN-gamma-induced IL-31RA upregulation in dermal microvascular endothelium is processed via JNK and PI3 kinase activation
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19730683 Observational study of gene-disease association. (HuGE Navigator)
19690585 The identification of OSMR and IL31RA gene pathology provides an explanation of the high prevalence of primary cutaneous amyloidosis in Taiwan as well as new insight into disease pathophysiology.
18926762 ). Binding of IL-31 to its receptor activates Jak/STAT, PI3K/AKT and MAPK pathways.[review]
18580959 IL-31 receptor alpha expression in epidermal keratinocytes is modulated by cell differentiation and interferon gamma
15194700 the molecular mechanisms underlying GPL-mediated signal transduction
14504285 GPL is a novel cytokine receptor related to GP130 and leukemia inhibitory factor receptor
11877449 A novel type I cytokine receptor is expressed on monocytes, signals proliferation, and activates STAT-3 and STAT-5.

AA Sequence

MMWTWALWMLPSLCKFSLAALPAKPENISCVYYYRKNLTCTWSPGKETSYTQYTVKRTYAFGEKHDNCTT      1 - 70
NSSTSENRASCSFFLPRITIPDNYTIEVEAENGDGVIKSHMTYWRLENIAKTEPPKIFRVKPVLGIKRMI     71 - 140
QIEWIKPELAPVSSDLKYTLRFRTVNSTSWMEVNFAKNRKDKNQTYNLTGLQPFTEYVIALRCAVKESKF    141 - 210
WSDWSQEKMGMTEEEAPCGLELWRVLKPAEADGRRPVRLLWKKARGAPVLEKTLGYNIWYYPESNTNLTE    211 - 280
TMNTTNQQLELHLGGESFWVSMISYNSLGKSPVATLRIPAIQEKSFQCIEVMQACVAEDQLVVKWQSSAL    281 - 350
DVNTWMIEWFPDVDSEPTTLSWESVSQATNWTIQQDKLKPFWCYNISVYPMLHDKVGEPYSIQAYAKEGV    351 - 420
PSEGPETKVENIGVKTVTITWKEIPKSERKGIICNYTIFYQAEGGKGFSKTVNSSILQYGLESLKRKTSY    421 - 490
IVQVMASTSAGGTNGTSINFKTLSFSVFEIILITSLIGGGLLILIILTVAYGLKKPNKLTHLCWPTVPNP    491 - 560
AESSIATWHGDDFKDKLNLKESDDSVNTEDRILKPCSTPSDKLVIDKLVVNFGNVLQEIFTDEARTGQEN    561 - 630
NLGGEKNGYVTCPFRPDCPLGKSFEELPVSPEIPPRKSQYLRSRMPEGTRPEAKEQLLFSGQSLVPDHLC    631 - 700
EEGAPNPYLKNSVTAREFLVSEKLPEHTKGEV                                          701 - 732
//

Text Mined References (26)

PMID Year Title
25283844 2015 The interleukin (IL)-31/IL-31R axis contributes to tumor growth in human follicular lymphoma.
24667097 2014 Distribution of IL-31 and its receptor expressing cells in skin of atopic dermatitis.
24373353 2014 A sensory neuron-expressed IL-31 receptor mediates T helper cell-dependent itch: Involvement of TRPV1 and TRPA1.
23392388 2013 Effects of interleukin-31 on MUC5AC gene expression in nasal allergic inflammation.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
21261663 2011 Functional effects of interleukin 31 in human primary keratinocytes.
20849534 2010 Interferon-? induces upregulation and activation of the interleukin-31 receptor in human dermal microvascular endothelial cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19690585 2010 Novel IL31RA gene mutation and ancestral OSMR mutant allele in familial primary cutaneous amyloidosis.
18926762 Structures and biological functions of IL-31 and IL-31 receptors.
18580959 2009 IL-31 receptor alpha expression in epidermal keratinocytes is modulated by cell differentiation and interferon gamma.
18439099 2008 Regulated expression of the IL-31 receptor in bronchial and alveolar epithelial cells, pulmonary fibroblasts, and pulmonary macrophages.
16461143 2006 IL-31 is associated with cutaneous lymphocyte antigen-positive skin homing T cells in patients with atopic dermatitis.
15627637 Predominant expression of the long isoform of GP130-like (GPL) receptor is required for interleukin-31 signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15194700 2004 Characterization of the signaling capacities of the novel gp130-like cytokine receptor.
15184896 2004 Interleukin 31, a cytokine produced by activated T cells, induces dermatitis in mice.
14504285 2003 GPL, a novel cytokine receptor related to GP130 and leukemia inhibitory factor receptor.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11877449 2002 A novel type I cytokine receptor is expressed on monocytes, signals proliferation, and activates STAT-3 and STAT-5.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.