Property Summary

NCBI Gene PubMed Count 57
PubMed Score 132.16
PubTator Score 107.11

Knowledge Summary

Patent

No data available

Gene RIF (56)

PMID Text
26944931 IL-31 affects keratinocyte differentiation in multiple ways and the IL-1 cytokine network is a major downstream effector of IL-31 signaling in deregulating the physical skin barrier.
26449657 An increase of IL-31 serum levels in postmenopausal women with decreased bone mineral density, is shown.
26357000 a possible systemic involvement of IL-31 and the absence of a systemic involvement of IL-33 in allergic contact dermatitis.
26306032 crucial requirements for IL-31 signaling and its counter-regulation by SOCS3
26198770 Oncostatin M and interleukin-31: Cytokines, receptors, signal transduction and physiology.
25756056 IL-31 is overexpressed in the lesional skin of LP but its expression does not correlate with intensity of pruritus.
25710085 In summary, TGF-beta1 and IL-31 were linked to progression from chronic hepatitis B to liver cirrhosis, and correlated well with the severity of disease.
25572240 the results suggest that IL-31 may be a candidate gene associated with the pathogenesis of rheumatoid arthritis
25534405 The results of this study suggest that the severity of atopic dermatitis in a Polish population is associated with some specific haplotypes of the IL-31 gene and renew questions concerning the role of IL-31 in pruritus in atopic dermatitis.
25488078 The results of our analyses regarding serum levels and receptor expression do not suggest a central role of IL-31 in Mycosis fungoides/Sezary syndrome pathogenesis.
25285475 IL-31 expression in allergic rhinitis aggravated and amplified Th2 inflammation as well as mucin production
25283844 The interleukin IL-31/IL-31receptor axis contributes to tumor growth in human follicular lymphoma.
25270263 IL-31 may play an important role in the pathophysiology of uremic pruritus.
25176053 The IL-31 serum level was significantly higher in cutaneous T-cell lymphoma patients than in the control group but there were no positive correlation between IL-31 serum level and pruritus.
25122210 IL-31 was increased after IVIG treatment in patients with KD and was significantly associated with CAL formation.
24984931 TARC and interleukin-31 may be biomarkers for adult atopic dermatitis
24943220 Data show that STAT6 and NF-kappaB are central players in mediating IL-31 expression induced by IL-4/IL-33.
24667097 IL-31-positive cells were observed as mononuclear infiltrating cells and as CD11b co-expressing cells in severe atopic dermatitis samples.
24573820 Case Report: sporadic lichen amyloidosis with high expression of Il31.
24515918 enhanced Th2 cytokine levels was correlated with IL-31 expression in NPs and provide a possible explanation for IL-31's regulatory role in the pathogenesis of NPs.
23874436 IL-31 seems to be another sweat stimulator.
23794184 EGFR-TK inhibitors could cause keratinocytes injury, the release of IL-33 and the consequent interaction with its receptor on mast cells, that induces the secretion of several factors capable to cause skin manifestations, included IL-31
23698099 CD4+CD26- malignant cells specifically produce IL-31 and clinical resolution of pruritus correlates with decreased IL-31 levels in the circulation
23694808 Il-31 is not a TH2 cytokine in the classical sense but is likely to be expressed by a number of cells in an allergic situation in which IL-4 is present and possibly contribute to the allergic reaction.
23621408 IL-31 induces pro-inflammatory effects in activated human macrophages via STAT-1 and 5 phosphorylation. Interleukin-31-induced ERK 1/2 activation contributes to the underlying mechanism of Th1 cytokine IL-12 suppression in macrophages.
23392388 IL-31 and IL-31RA are upregulated in patients with allergic rhinitis, and induce MUC5AC gene expression in human airway epithelial cells.
22827739 hypothesize that an altered regulation of IL-31 gene expression influence clinical course of AD. The available published data and our results lend support to an important role of IL-31 gene polymorphism in AD pathogenesis
22621183 T cells in chronic atopic dermatitis (AD) skin produce IL-31 and AD lesions contain increased levels of these IL-31-producing T cells.
22539792 IL-31-specific activation of dendritic cells may be part of a positive feedback loop driving the progression of inflammatory skin diseases.
22509760 IL-31 serum levels correlate with the SCORAD score, sleeplessness, and Th2 cytokines including IL-4 and IL-13, in sixty children with the extrinsic type of atopic dermatitis.
22177328 This study suggests that IL-31 is an important regulator of keratinocyte differentiation and demonstrates a link between the presence of IL-31 in skin, as found in patients with atopic dermatitis, and filaggrin expression
22017185 Distinct SPINK5 and IL-31 gene variants (SNPs) were associated with the development of atopic eczema and non-atopic hand dermatitis in Taiwanese nurses.
21952721 IL-31-631 T>G polymorphism was significantly associated with IL-31 blood level but not with disease susceptibility.
21294778 IL-31 is important in atopic dermatitis pathophysiology.
21261663 Our findings show a functional role of IL-31 in human primary keratinocytes and provide a new link between TLR-2 ligands and IL-31 which might be dysregulated in atopic dermatitis.
21211659 IL-31 displays a unique and independent role in the pathophysiology of allergic rhinitis
21182835 Data not only illustrate various functions that cysteines perform during IL-31 biosynthesis and secretion, but also highlight their potential roles in cytokine effector functions.
21057749 Letter: polymorphisms in the IL-31 gene do not appear to underlie epidermolysis bullosa pruriginosa.
21057749 Observational study of gene-disease association. (HuGE Navigator)
20410259 induces pro-inflammatory cytokines and atopic dermatitis-related chemokines in eosinophils
20190140 The ability of beta-defensins and cathelicidin LL-37 to stimulate the production and release of IL-31 by human mast cells provides a novel mechanism by which skin-derived antimicrobial peptides/proteins may contribute to inflammatory reactions
20163453 IL-31 serum levels may play a role in the pathophysiology of chronic spontaneous urticaria.
19920145 IL-31 recognizes its receptor complex through two different binding sites
19889120 regulation of the IL-31 receptor and pro-inflammatory functions of IL-31 in human monocytes and monocyte-derived cells
19281909 Human CD4(+) T cells express a functional H(4)R. The receptor is upregulated under T(H)2 conditions, and its stimulation leads to induction of AP-1 and IL-31.
18926762 IL-31 acts on a broad range of immune- & non-immune cells & possesses potential pleiotropic physiological functions, including regulating hematopoiesis & immune response, causing inflammatory bowel disease, airway hypersensitivity & dermatitis[review]
18839421 unlike eczema, genetic variation at COL29A1 and IL31 loci is unlikely to implact inflammatory bowel disease risk
18802341 overexpressed in patients with atopic dermatitis; staphylococcal superantigens induce expression in atopic individuals
18678344 serum IL-31 levels were significantly higher in patients with atopic dermatitis (AD) compared with control subjects; findings provide evidence that IL-31 has a role in AD pathophysiology with regard to pruritus and skin inflammation
18439099 The data suggest that increased IL-31Ralpha expression correlates with an enhanced response to IL-31.
17900679 Observational study of gene-disease association. (HuGE Navigator)
17900679 This study presents the first genetic risk factor for the nonatopic type of eczema and indicates a primary role of IL-31-induced pruritus in the initiation of this disease.
17487427 IL-31 is a potent inducer of proinflammatory mediators in human colonic SEMFs. IL-31 may function as a proinflammatory cytokine derived from Th2 cells.
16461143 IL-31 expression is associated with CLA(+) T cells and might contribute to the development of atopic dermatitis-induced skin inflammation and pruritus
16461142 Significantly upregulated in pruritic atopic dermatitis. These findings provide a new link among staphylococcal colonization, subsequent T-cell recruitment/activation, and pruritus induction in patients with atopic dermatitis.
15925362 Findings suggest that IL-31 may participate in the cause of itch sensation and promote scratching behavior in NC/Nga mice with atopic dermatitis.

AA Sequence

MASHSGPSTSVLFLFCCLGGWLASHTLPVRLLRPSDDVQKIVEELQSLSKMLLKDVEEEKGVLVSQNYTL      1 - 70
PCLSPDAQPPNNIHSPAIRAYLKTIRQLDNKSVIDEIIEHLDKLIFQDAPETNISVPTDTHECKRFILTI     71 - 140
SQQFSECMDLALKSLTSGAQQATT                                                  141 - 164
//

Text Mined References (58)

PMID Year Title
26944931 2016 Control of the Physical and Antimicrobial Skin Barrier by an IL-31-IL-1 Signaling Network.
26449657 2015 Increased levels of interleukin 31 (IL-31) in osteoporosis.
26357000 2015 IL-31 and IL-33 circulating levels in allergic contact dermatitis.
26306032 2015 Prerequisites for Functional Interleukin 31 Signaling and Its Feedback Regulation by Suppressor of Cytokine Signaling 3 (SOCS3).
26198770 2015 Oncostatin M and interleukin-31: Cytokines, receptors, signal transduction and physiology.
25756056 2015 IL-31 is overexpressed in lichen planus but its level does not correlate with pruritus severity.
25710085 2015 Elevated TGF-?1/IL-31 Pathway Is Associated with the Disease Severity of Hepatitis B Virus-Related Liver Cirrhosis.
25572240 2014 Polymorphisms of interleukin-31 are associated with anti-CCP levels in females with rheumatoid arthritis.
25534405 2015 The frequencies of haplotypes defined by three polymorphisms of the IL-31 gene: -1066, -2057, and IVS2+12 in Polish patients with atopic dermatitis.
25488078 2015 Analysis of the IL-31 pathway in Mycosis fungoides and Sézary syndrome.
25285475 2015 Interleukin-31 promotes helper T cell type-2 inflammation in children with allergic rhinitis.
25283844 2015 The interleukin (IL)-31/IL-31R axis contributes to tumor growth in human follicular lymphoma.
25270263 2014 Interleukin-31 is associated with uremic pruritus in patients receiving hemodialysis.
25176053 2015 Il-31 does not correlate to pruritus related to early stage cutaneous T-cell lymphomas but is involved in pathogenesis of the disease.
25122210 2014 IL-31 associated with coronary artery lesion formation in Kawasaki disease.
24984931 2014 Serum thymus and activation-regulated chemokine (TARC) and interleukin-31 levels as biomarkers for monitoring in adult atopic dermatitis.
24943220 2014 Human Th2 but not Th9 cells release IL-31 in a STAT6/NF-?B-dependent way.
24667097 2014 Distribution of IL-31 and its receptor expressing cells in skin of atopic dermatitis.
24573820 2015 A Th2 cytokine interleukin-31 signature in a case of sporadic lichen amyloidosis.
24515918 2014 Role of IL-31 in regulation of Th2 cytokine levels in patients with nasal polyps.
23874436 2013 Eccrine sweat contains IL-1?, IL-1? and IL-31 and activates epidermal keratinocytes as a danger signal.
23794184 2013 IL-33/IL-31 axis: a new pathological mechanisms for EGFR tyrosine kinase inhibitors-associated skin toxicity.
23698099 2013 IL-31 is produced by the malignant T-cell population in cutaneous T-Cell lymphoma and correlates with CTCL pruritus.
23694808 2013 Human IL-31 is induced by IL-4 and promotes TH2-driven inflammation.
23621408 2013 Interleukin (IL)-31 activates signal transducer and activator of transcription (STAT)-1, STAT-5 and extracellular signal-regulated kinase 1/2 and down-regulates IL-12p40 production in activated human macrophages.
23392388 2013 Effects of interleukin-31 on MUC5AC gene expression in nasal allergic inflammation.
22827739 2013 Association of distinct IL-31 polymorphisms with pruritus and severity of atopic dermatitis.
22621183 2012 Increased frequencies of IL-31-producing T cells are found in chronic atopic dermatitis skin.
22539792 2012 Dendritic cells activated by IFN-?/STAT1 express IL-31 receptor and release proinflammatory mediators upon IL-31 treatment.
22509760 2012 IL-31 significantly correlates with disease activity and Th2 cytokine levels in children with atopic dermatitis.
22177328 2012 IL-31 regulates differentiation and filaggrin expression in human organotypic skin models.
22017185 2011 Distinct SPINK5 and IL-31 polymorphisms are associated with atopic eczema and non-atopic hand dermatitis in Taiwanese nursing population.
21952721 2012 Functional regulation of interleukin-31 production by its genetic polymorphism in patients with extrinsic atopic dermatitis.
21294778 2011 Serum measurement of interleukin-31 (IL-31) in paediatric atopic dermatitis: elevated levels correlate with severity scoring.
21261663 2011 Functional effects of interleukin 31 in human primary keratinocytes.
21211659 2011 Characterization of pollen antigen-induced IL-31 production by PBMCs in patients with allergic rhinitis.
21182835 2011 Diverse functions of reactive cysteines facilitate unique biosynthetic processes of aggregate-prone interleukin-31.
21057749 2010 Common IL-31 gene haplotype associated with non-atopic eczema is not implicated in epidermolysis bullosa pruriginosa.
20410259 2010 Activation of human eosinophils and epidermal keratinocytes by Th2 cytokine IL-31: implication for the immunopathogenesis of atopic dermatitis.
20190140 2010 Antimicrobial peptides human beta-defensins and cathelicidin LL-37 induce the secretion of a pruritogenic cytokine IL-31 by human mast cells.
20163453 2010 Increased levels of serum IL-31 in chronic spontaneous urticaria.
19920145 2010 Molecular dissection of human interleukin-31-mediated signal transduction through site-directed mutagenesis.
19889120 2010 Interleukin (IL)-31 induces pro-inflammatory cytokines in human monocytes and macrophages following stimulation with staphylococcal exotoxins.
19281909 2009 The histamine H4 receptor is functionally expressed on T(H)2 cells.
18926762 Structures and biological functions of IL-31 and IL-31 receptors.
18839421 2009 No association between the eczema genes COL29A1 and IL31 and inflammatory bowel disease.
18802341 2008 Regulatory role of T lymphocytes in atopic dermatitis.
18678344 2008 Correlation of IL-31 serum levels with severity of atopic dermatitis.
18439099 2008 Regulated expression of the IL-31 receptor in bronchial and alveolar epithelial cells, pulmonary fibroblasts, and pulmonary macrophages.
17900679 2007 A common haplotype of the IL-31 gene influencing gene expression is associated with nonatopic eczema.
17487427 2007 Interleukin-31 stimulates production of inflammatory mediators from human colonic subepithelial myofibroblasts.
17030248 2006 Enhanced expression levels of IL-31 correlate with IL-4 and IL-13 in atopic and allergic contact dermatitis.
16461143 2006 IL-31 is associated with cutaneous lymphocyte antigen-positive skin homing T cells in patients with atopic dermatitis.
16461142 2006 IL-31: a new link between T cells and pruritus in atopic skin inflammation.
15925362 2005 Expression of IL-31 gene transcripts in NC/Nga mice with atopic dermatitis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15184896 2004 Interleukin 31, a cytokine produced by activated T cells, induces dermatitis in mice.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.