1. Home
  2. Targets
  3. signaling molecule
  4. cytokine
  5. interleukin superfamily
  6. Interleukin-26

Tbio Interleukin-26

May play a role in local mechanisms of mucosal immunity and seems to have a proinflammatory function. May play a role in inflammatory bowel disease. Activates STAT1 and STAT3, MAPK1/3 (ERK1/2), JUN and AKT. Induces expression of SOCS3, TNF-alpha and IL-8, secretion of IL-8 and IL-10 and surface expression of ICAM1. Decreases proliferation of intestinal epithelial cells. Is inhibited by heparin.

This gene was identified by its overexpression specifically in herpesvirus samimiri-transformed T cells. The encoded protein is a member of the IL10 family of cytokines. It is a secreted protein and may function as a homodimer. This protein is thought to contribute to the transformed phenotype of T cells after infection by herpesvirus samimiri. [provided by RefSeq, Jul 2008]

 Comments

Property Summary

NCBI Gene PubMed Count 28
PubMed Score 32.10
PubTator Score 33.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Atopic dermatitis 944 6.8e-05
cystic fibrosis 1670 3.5e-04
group 3 medulloblastoma 2254 8.2e-03
interstitial cystitis 2299 3.0e-02
Disease Target Count Z-score Confidence
ulcerative colitis 2087 0.0 2.0
Disease Target Count Z-score Confidence
Crohn's disease 304 3.525 1.8
psoriasis 6685 3.2 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
cystic fibrosis -1.727 3.5e-04
Atopic dermatitis 1.200 6.8e-05
interstitial cystitis 1.500 3.0e-02
group 3 medulloblastoma 1.900 8.2e-03
psoriasis 4.500 5.4e-103

Synonym

Accession Q9NPH9 IL-26
Symbols AK155
IL-26

Gene

IL26

PANTHER Protein Class (3)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (5)

 GO Function (1)

 GO Component (2)

 GO Process (10)

 Compartment GO Term (11)

 HCA RNA Cell Line (16)

See all...

Pathway (1)

Gene RIF (17)

PMID Text
27029915 Our study indicates that IL-26 is a potential biomarker of disease severity in pediatric asthma without signs of Th2-mediated inflammation.
26202572 IL-26 is emerging as a potentially important player in host defense and may also be a pathogenic factor in the chronic inflammatory disorders of humans. [Review]
25157980 The negative influence of IL-26 on the anti-mycobacterial activity and its constitutive presence in both serum and monocyte supernatants prompt a proposal that IL26 as a candidate gene for tuberculosis susceptibility.
23875025 IL-26 differentially modulates the infection by different enveloped viruses.
23704922 Elevated levels of IL-26 in human gastric cancer promote proliferation and survival by modulating STAT1/STAT3 signaling.
23055831 IL-26 appears as a novel proinflammatory cytokine, located upstream of the proinflammatory cascade, that may constitute a promising target to treat rheumatoid arthritis and chronic inflammatory disorders.
22622197 Identify a second enhancer element positioned between IL26 and IFNG required for both IL26 and IFNG expression. One function of this enhancer is to facilitate recruitment of RNA polymerase II to promoters of both genes.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20176734 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18332247 Observational study of gene-disease association. (HuGE Navigator)
17703412 Observational study of gene-disease association. (HuGE Navigator)
15178681 sensitivity to recombinant interleukin-26(IL-26) of various cell lines strictly correlated with the expression of IL-20 receptor 1 and blocking antibodies against either IL-10 receptor 2 or IL-20 receptor 1 inhibited IL-26-dependent signal transduction
14764663 The active receptor complex for IL-26 is a heterodimer composed of two receptor proteins: IL-20 receptor 1 and IL-10 receptor 2. Signaling through the IL-26 receptor results in activation of STAT1 and STAT3.
14558082 common polymorphisms in the IFNgamma/IL-26 gene region may contribute to sex bias in susceptibility to rheumatoid arthritis, by distorting the propensity of female carriers versus male carriers to contract this disease.

AA Sequence 

MLVNFILRCGLLLVTLSLAIAKHKQSSFTKSCYPRGTLSQAVDALYIKAAWLKATIPEDRIKNIRLLKKK      1 - 70
TKKQFMKNCQFQEQLLSFFMEDVFGQLQLQGCKKIRFVEDFHSLRQKLSHCISCASSAREMKSITRMKRI     71 - 140
FYRIGNKGIYKAISELDILLSWIKKLLESSQ                                           141 - 171
//

Text Mined References (28)

PMID Year Title
27029915 2016 The cytokine interleukin-26 as a biomarker in pediatric asthma.
26202572 2016 Interleukin-26: An Emerging Player in Host Defense and Inflammation.
25157980 2015 Microarray analysis of Mycobacterium tuberculosis-infected monocytes reveals IL26 as a new candidate gene for tuberculosis susceptibility.
23875025 2013 The cationic cytokine IL-26 differentially modulates virus infection in culture.
23704922 2013 IL-26 promotes the proliferation and survival of human gastric cancer cells by regulating the balance of STAT1 and STAT3 activation.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23055831 2012 IL-26 is overexpressed in rheumatoid arthritis and induces proinflammatory cytokine production and Th17 cell generation.
22622197 2012 Lineage-specific adjacent IFNG and IL26 genes share a common distal enhancer element.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20228799 2010 Genome-wide association identifies multiple ulcerative colitis susceptibility loci.
20176734 2010 Comparative genetic analysis of inflammatory bowel disease and type 1 diabetes implicates multiple loci with opposite effects.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19122664 2009 Ulcerative colitis-risk loci on chromosomes 1p36 and 12q15 found by genome-wide association study.
18483078 2009 The role of the novel Th17 cytokine IL-26 in intestinal inflammation.
18332247 2008 Interferon gamma allelic variants: sex-biased multiple sclerosis susceptibility and gene expression.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15178681 2004 The T-cell lymphokine interleukin-26 targets epithelial cells through the interleukin-20 receptor 1 and interleukin-10 receptor 2 chains.
14764663 2004 Cutting edge: IL-26 signals through a novel receptor complex composed of IL-20 receptor 1 and IL-10 receptor 2.
14558082 2003 Polymorphisms in the interferon-gamma/interleukin-26 gene region contribute to sex bias in susceptibility to rheumatoid arthritis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11528524 2001 Novel polymorphisms in the IL-10 related AK155 gene (chromosome 12q15).
11197690 2000 IL-TIF/IL-22: genomic organization and mapping of the human and mouse genes.
10729163 2000 Induction of a novel cellular homolog of interleukin-10, AK155, by transformation of T lymphocytes with herpesvirus saimiri.