Property Summary

NCBI Gene PubMed Count 52
PubMed Score 75.55
PubTator Score 102.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (44)

PMID Text
27089063 Findings indicate that the release of interleukin 25 (IL-25) from tumour-associated fibroblasts (TAFs) may serve as a check point for control of mammary tumour metastasis.
27000993 Therefore, IL-17E/IL-17RB signaling represents a potential therapeutic target for treatment of hepatocellular carcinoma
26845056 IL-8 and IL-25 are targets of miR-20b.
26762527 Our findings indicate that the alarmin cytokines IL-33 and IL-25 increase basophil activation and migratory potential, and may pose as a novel therapeutic targets for the treatment of allergic asthma.
26356122 expression of immunoreactivity for IL-17A, IL-17RA, IL-17E, and IL-17F was significantly elevated in prostatic tissue from benign prostatic hyperplasia and prostate cancer compared with that in controls
26347322 The IL17E rs79877597 SNP was a modifier of the risk for psoriasis disease severity and psoriatic arthritis.
26321145 IL-25 upregulated PD-L1 surface expression through the signaling pathways of JNK and STAT3, with STAT3 found to constitutively occupy the proximal region of the PD-L1 promoter.
25975248 IL-25 overexpression was observed in eosinophilic chronic rhinosinusitis and may serve as a mediator of eosinophilic CRS.
25903653 we have demonstrated that the expression of ET-1 and IL-25 was coordinately upregulated in the lesional keratinocytes of patients with AD and a murine AD model.
25705788 This article focuses on evidence for the role of IL-25, IL-33 and TSLP in human allergic disease; although this triad of cytokines is described as epithelial derived, it is clear that their expression within lung tissue is much more widespread.[Review]
25704964 increased levels in patients with chronic rhinosinusitis with nasal polyps
25676453 The levels of mRNA for IL-25 were not significantly elevated in parotid gland tissues from Kimura Disease patients as compared to controls.
25273095 asthmatic epithelial cells have an increased intrinsic capacity for expression of a pro-type 2 cytokine in response to a viral infection, and IL-25 is a key mediator of RV-induced exacerbations of pulmonary inflammation
25133876 Because IL-25 has a major role in triggering type 2 responses, bronchial epithelial IL-25 expression is likely a key determinant of type 2 response activation in asthma
24746746 Human chorionic gonadotropin up-regulates Il25, promoting the proliferation of decidual stromal cells by activation of JNK and AKT signal pathways.
24344271 IL-25 and type 2 innate lymphoid cells have roles in development of pulmonary fibrosis
24323357 IL-25 and IL-33-driven type-2 innate lymphoid cells have roles in atopic dermatitis
24247484 The increased IL-25 levels in plasma and the expression of IL-17RA and IL-17RB on eosinophils in allergic asthma patients suggests that IL-25 may activate eosinophils during allergic inflammation.
23957336 Patients with the 'IL-5, IL-17A, IL-25-high' airway inflammatory pattern are often uncontrolled asthmatics, despite daily treatment.
23810766 Our data demonstrate that IL-33 plays a critical role in the rapid induction of airway contraction by stimulating the prompt expansion of IL-13-producing type 2 innate lymphoid cells, whereas IL-25-induced responses are slower and less potent.
23657503 IL-25 enhances herpes simplex virus (HSV)-1 and vaccinia virus replication by inhibiting filaggrin expression, and IL-25 acts synergistically with IL-4 and IL-13 to enhance HSV-1 replication in vitro
23590308 Suggest that IL-25 production by airway epithelial cells is regulated by the transcription and protein release levels and that allergen proteases likely play pivotal roles in both biological processes.
23564603 IL-25 expression is markedly reduced during human and experimental fulminant hepatitis.
23429464 IL-25 Is Decreased in Sera of Patients With inflammatory bowel disease.
22691357 IL-25 secreted from epithelial cells has the potential to promote airway remodeling in asthma.
22266274 We observed significant downregulation of IL-25 in women with recurrent miscarriage compared with controls.
21570719 Allergen provocation induces functionally relevant, increased expression of IL-25 and its receptor in the asthmatic bronchial mucosa and dermis of sensitized atopic subjects.
21205894 Findings suggest that IL-25 is elevated in asthma and contributes to angiogenesis.
20944558 IL-25 production is differently regulated by TNF-alpha and TGF-beta1 in the human g
20861853 IL-25 may have a role in atopic dermatitis
20729468 Eosinophils are the main source of IL-25, whereas activated CD4+ memory T cells are the IL-17RB-expressing cells in Churg-Strauss syndrome.
20492545 production is linked to the amount of specific IgE antibodies in blood samples of 6 yr old children in Germany
20237496 Observational study of gene-disease association. (HuGE Navigator)
19968632 IL-17A and IL-25 had opposing effects on thymic stromal lymphopoietin regulation in human nasal epithelial cells
19329997 MMP7 coordinates allergic lung inflammation by activating interleukin 25 while simultaneously inhibiting retinoid-dependent development of regulatory T cells.
19129540 IL-25 is a negative regulator of monocyte proinflammatory cytokine responses
19095584 Higher expressions of IL-17E, IL-17A, IL-17BR and IL-17R are associated with oral inflammation.
17889290 Blocking IL-25 in an experimental model of allergic asthma prevents airway hyperresponsiveness, a critical feature of clinical asthma.
17719653 The upregulation of costimulation-induced IL-25 receptors and release of cytokines and chemokines from IL-25 treated costimulated Th cells were differentially regulated by intracellular JNK, p38 MAPK and NF-kappaB activity.
17635955 IL-25 produced by innate effector eosinophils and basophils may augment the allergic inflammation by enhancing the maintenance and functions of TSLP-DC activated adaptive Th2 memory cells
16950278 IL-25 acts by amplifying TH2 cell-mediated allergic airway inflammation. IL-25 itself does not significantly induce allergic inflammation in vivo.
16522458 IL-17E may contribute to the induction and maintenance of eosinophilic inflammation by acting on lung fibroblasts. This supports a role for IL-17E in asthma pathophysiology.
12239140 Transgenic overexpression from humans into mice results in eosinophilia, B-lymphocyte hyperplasia, and altered antibody production.
11714825 Overexpression of IL-17E up-regulates gene expression of Th2 cytokines and induces growth retardation, jaundice, and multiorgan inflammation in a transgenic mouse model.

AA Sequence

MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRH      1 - 70
PESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVF     71 - 140
YRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG                                     141 - 177
//

Text Mined References (52)

PMID Year Title
27089063 2016 Induction of IL-25 secretion from tumour-associated fibroblasts suppresses mammary tumour metastasis.
27000993 2016 Non-CSCs nourish CSCs through interleukin-17E-mediated activation of NF-?B and JAK/STAT3 signaling in human hepatocellular carcinoma.
26845056 2015 Disease-specific signature of serum miR-20b and its targets IL-8 and IL-25, in myasthenia gravis patients.
26762527 2016 IL-25 and IL-33 induce Type 2 inflammation in basophils from subjects with allergic asthma.
26356122 2015 Expression of IL-17A, E, and F and their receptors in human prostatic cancer: Comparison with benign prostatic hyperplasia.
26347322 2015 Association between single nucleotide polymorphisms IL17RA rs4819554 and IL17E rs79877597 and Psoriasis in a Spanish cohort.
26321145 2015 Interleukin-25 Mediates Transcriptional Control of PD-L1 via STAT3 in Multipotent Human Mesenchymal Stromal Cells (hMSCs) to Suppress Th17 Responses.
25975248 Interleukin-25 and interleukin-33 as mediators of eosinophilic inflammation in chronic rhinosinusitis.
25903653 2015 Mutual upregulation of endothelin-1 and IL-25 in atopic dermatitis.
25705788 2015 Epithelial cytokines and pulmonary allergic inflammation.
25704964 2015 Interleukin-25 and mucosal T cells in noneosinophilic and eosinophilic chronic rhinosinusitis.
25676453 2015 Increased expression of thymic stromal lymphopoietin and its receptor in Kimura's disease.
25273095 2014 Rhinovirus-induced IL-25 in asthma exacerbation drives type 2 immunity and allergic pulmonary inflammation.
25133876 2014 Epithelial interleukin-25 is a key mediator in Th2-high, corticosteroid-responsive asthma.
24746746 2014 Interleukin-25 induced by human chorionic gonadotropin promotes the proliferation of decidual stromal cells by activation of JNK and AKT signal pathways.
24344271 2014 IL-25 and type 2 innate lymphoid cells induce pulmonary fibrosis.
24323357 2013 A role for IL-25 and IL-33-driven type-2 innate lymphoid cells in atopic dermatitis.
24247484 2014 IL-25 and IL-25 receptor expression on eosinophils from subjects with allergic asthma.
23957336 2013 Sputum cytokine mapping reveals an 'IL-5, IL-17A, IL-25-high' pattern associated with poorly controlled asthma.
23810766 2013 IL-33 is more potent than IL-25 in provoking IL-13-producing nuocytes (type 2 innate lymphoid cells) and airway contraction.
23657503 2013 IL-25 enhances HSV-1 replication by inhibiting filaggrin expression, and acts synergistically with Th2 cytokines to enhance HSV-1 replication.
23590308 2013 Transcription of interleukin-25 and extracellular release of the protein is regulated by allergen proteases in airway epithelial cells.
23564603 2013 IL-25 prevents and cures fulminant hepatitis in mice through a myeloid-derived suppressor cell-dependent mechanism.
23429464 IL-25 downregulates Th1/Th17 immune response in an IL-10-dependent manner in inflammatory bowel disease.
22691357 2012 [IL-25 derived from epithelial cells has the potential to promote airway remodeling in asthma].
22266274 2012 The involvement of inflammatory cytokines in the pathogenesis of recurrent miscarriage.
21980299 2011 A genome-wide meta-analysis of six type 1 diabetes cohorts identifies multiple associated loci.
21570719 2011 Allergen-induced expression of IL-25 and IL-25 receptor in atopic asthmatic airways and late-phase cutaneous responses.
21205894 2011 T-helper cell type 2 (Th2) memory T cell-potentiating cytokine IL-25 has the potential to promote angiogenesis in asthma.
20944558 2011 Interleukin-25 production is differently regulated by TNF-? and TGF-?1 in the human gut.
20861853 2011 IL-25 in atopic dermatitis: a possible link between inflammation and skin barrier dysfunction?
20729468 2010 Interleukin-25: a cytokine linking eosinophils and adaptive immunity in Churg-Strauss syndrome.
20492545 2010 IL-17E but not IL-17A is associated with allergic sensitization: results from the LISA study.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19968632 2010 Opposing roles of IL-17A and IL-25 in the regulation of TSLP production in human nasal epithelial cells.
19329997 2009 Divergent functions for airway epithelial matrix metalloproteinase 7 and retinoic acid in experimental asthma.
19129540 2009 Inhibition of monocyte-derived inflammatory cytokines by IL-25 occurs via p38 Map kinase-dependent induction of Socs-3.
19095584 2008 Chosen IL-17 family proteins in neutrophils of patients with oral inflammation.
17889290 2007 Blocking IL-25 prevents airway hyperresponsiveness in allergic asthma.
17719653 2007 Intracellular JNK, p38 MAPK and NF-kappaB regulate IL-25 induced release of cytokines and chemokines from costimulated T helper lymphocytes.
17635955 2007 IL-25 augments type 2 immune responses by enhancing the expansion and functions of TSLP-DC-activated Th2 memory cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16950278 2006 IL-25 enhances allergic airway inflammation by amplifying a TH2 cell-dependent pathway in mice.
16522458 2006 IL-17E upregulates the expression of proinflammatory cytokines in lung fibroblasts.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12239140 2002 Transgenic overexpression of human IL-17E results in eosinophilia, B-lymphocyte hyperplasia, and altered antibody production.
11754819 2001 IL-25 induces IL-4, IL-5, and IL-13 and Th2-associated pathologies in vivo.
11714825 2001 Forced expression of murine IL-17E induces growth retardation, jaundice, a Th2-biased response, and multiorgan inflammation in mice.
11058597 2001 IL-17E, a novel proinflammatory ligand for the IL-17 receptor homolog IL-17Rh1.