Property Summary

NCBI Gene PubMed Count 122
PubMed Score 766.65
PubTator Score 276.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus 2.900 2.6e-04
osteosarcoma -3.412 3.5e-10
cystic fibrosis 1.105 5.6e-03
tuberculosis -1.900 1.8e-06
colon cancer 1.200 3.4e-03
interstitial cystitis 2.800 3.6e-02
ulcerative colitis 2.200 1.0e-02
psoriasis 2.500 1.2e-74

 IMPC Phenotype (1)

Protein-protein Interaction (3)

Gene RIF (105)

PMID Text
26977011 IL20R1 correlated with prognosis of patients with pancreatic cancer, and mediates pancreatic cancer cell growth and migration. It may be a potential biomarker for IL24 molecular-targeted therapy.
26486636 This study demonstrated that IL-19 and IL-24 are associated with the modulation of T-cell responses in filarial infections.
26367324 The anti-viral effect of IL-24 correlated with caspase-3 activation and could be blocked by a pan-caspase inhibitor and by small interfering RNA (siRNA) directed towards TLR3.
26168134 This study indicates that IL-24 upregulates expression and activation of double-stranded RNA-activated protein kinase, further increasing expression and activation of eIF-2alpha, and decreasing Bcl-2 to promote apoptosis.
26097559 gene transfer to drive IL24 expression in chronic myeloid leukemia cell lines resulted in cytotoxicity specifically to cancer cells.
25778843 IL-24 may enhance tumor chemosensitivity to cisplatin.
25479732 Data show that Adenovirus-mediated interleukin 24 (Ad-IL-24) gene therapy suppresses growth of lung carcinoma cells SPC-A1 both in vitro and in vivo.
25236495 MDA-7/IL-24 inhibits Nrf2-mediated antioxidant response through activation of p38 pathway and inhibition of ERK pathway involved in cancer cell apoptosis.
25178435 Distribution of interleukin-10 family cytokines in serum and synovial fluid of patients with inflammatory arthritis reveals different
25091574 High expression of IL-24 was significantly correlated with second primary malignancy indicator in head and neck squamous cell carcinoma.
25001534 MDA-7/IL-24: multifunctional cancer killing cytokine.
24552169 The association of IL-24 polymorphisms with metabolic and cardiovascular risk factors.
24527982 elevated gene expression in Mexican mestizo patients with active Crohn's disease
24282278 MDA-7/IL-24 has a role in cancer-specific apoptosis through SARI induction
24270662 These results suggest a possible contribution of IL-24 to squamous cell carcinoma invasion via enhancing focal expression of MMP7.
24211183 IL-24 was strongly expressed in human psoriatic epidermis. Pharmacological inhibition of NF-kappaB increased IL-24 expression in TNF-stimulated human primary keratinocytes.
24084981 We found that IL-24 effectively inhibits SH-SY5Y neuroblastoma cell migration and invasion by changing subcellular localization and cellular levels of beta-catenin and regulating the levels of proteins associated with cell migration and invasion
23988449 OPRS1 mediates IL-24-induced cancer-specific apoptosis.
23982423 this study indicates that overexpression of IL-24 gene can significantly promote chemosensitivity in MDR phenotype SGC7901/CDDP gastric cancer cells.
23772146 The role of mda-7/IL-24 is inhibits decreasing of adhesion and invasion in vitro, blocking cell cycle, down-regulating the expression of ICAM-1, MMP-2/9, CDK1, the phosphorylation of ERK and Akt, NF-kappaB and AP-1 transcription activity.
23768573 mediates T cell microvesicles-induced mast cell activation; contributes to T cell-mediated skin inflammation
23722307 MDA-7/IL-24 overexpression decreased the expression of CD44.
23720015 Our findings demonstrate that MDA-7/IL-24 is be a safe and effective way to eradicate cancers and also potentially establish disease-free survival
23692552 The results suggest that IL-24 can induce neuroblastoma cell differentiation and apoptosis and may be a potential therapeutic agent for neuroblastoma.
23546515 This suggests that IL-24 plays a profound role in suppressing tumour lymphangiogenesis, thereby, reducing the likelihood of cancer metastasis via the lymphatic route.
23468528 a novel MDA-7/IL-24-GAS3-beta1integrin-fibronectin signaling pathway that suppresses breast cancer growth, is reported.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of interleukin 24 (IL24) in peptide-treated PBMCs
23110359 IL-24 appears to promote wound chronicity via its inhibitory effect on the migratory behavior of human keratinocytes, mediated through an AKT-dependent pathway.
23078624 Data suggest that IL24 is ubiquitinated and degraded by 26S proteasomes; data from site-directed mutagenesis study suggest that lysine 123 is the major internal lysine involved in ubiquitination of IL24; K123R mutant promotes apoptosis of HeLa cells.
23063979 this study may provide a novel mechanism of action of IL-24 in cardiovascular disease and indicates that IL-24 is a potential therapeutic agent in VSMC calcification.
22917968 results demonstrate that the inflammatory cytokines TNFalpha and IL24 are direct targets of miR-203 in keratinocytes
22475191 Transduction of murine tumors with adenoviruses expressing the human IL-24 gene however suppressed the viability and decreased the tumor growth
22248086 RGD-IL-24 can enhance the apoptosis of tumor cells and may provide a promising drug in tumor therapy.
21931671 Data show that mda-7/IL-24 activation leads to upregulation of growth arrest and DNA damage inducible (GADD) 45 alpha and gamma and JNK activation.
21922126 IL-24 is expressed in chronic pancreatitis tissue, and may play a role in the pathophysiology of chronic pancreatitis via autocrine pathways.
21843952 regulation suggests that alternative splicing of mda-7/IL-24 is under tight control in the cell, and can be modified under various cellular conditions, such as DNA damage
21787878 IL-24 could activate human CD8(+) T cells, driving CD8(+) T cells to produce interferon-gamma (IFN-gamma) and counteract tuberculosis.
21732348 Results identify clusterin (CLU) as a MDA-7/IL-24 interacting protein in DU-145 cells and investigate the role of MDA-7/IL-24 in regulating CLU expression and mediating the antitumor properties of mda-7/IL-24 in prostate cancer.
21524313 The presence of TGase-4 has a biological impact on a prostate cancer cell's response to MDA-7.
21448421 IL-24 expression was significantly correlated with histological differentiation, and inversely correlated with the degree of lymph node involvement in stage III rectal cancer.
21282359 Data show the specific differentiation-inducing effects of mda-7/IL-24 and IL-24 delE5 on myeloid leukemic cells.
21109977 mda-7/IL-24 has the potential to serve as a tool for targeted gene therapy in the treatment of gallbladder cancer
20976276 Observational study of gene-disease association. (HuGE Navigator)
20962850 Observational study of gene-disease association. (HuGE Navigator)
20858700 MDA-7/IL-24 markedly induces apoptosis in and suppresses the colony-forming capacity of primary blasts in acute myeloid leukemia but exerts minimal toxicity toward normal CD34-positive hematopoietic progenitor cells.
20545760 IL-24 functions during an inflammatory response in the skin by inhibiting the proliferation and migration of keratinocytes.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20383178 found that the histone acetylation level and the binding of the transcriptional factor Sp1 to the interleukin-24 promoter were reduced upon HDAC4 treatment.
20216471 IL-24 has a role in sensitizing melanoma cells to erlotinib through modulation of the Apaf-1 and Akt signaling pathways
20103619 Findings indicate that mda-7/IL-24 induces PERK activation that triggers production of ceramide, ceramide synthase 6 and thioredoxin, which in turn promote glioma cell autophagy and cell death.
20072629 here report p38 MAPK as a regulator of IL-24 expression and determine interference with destabilization mediated by the 3' UTR of IL-24 mRNA as mode of action
20061404 IL-24 transgenic mice manifest many similar phenotypes to that of mouse IL-20 and IL-22, including neonatal lethality, epidermal hyperplasia, and abnormal keratinocyte differentiation.
19965640 results indicate that IL-24 is a novel cytokine involved in T-dependent antigen (Ag)-driven B-cell differentiation and suggest its physiologic role in favoring germinal center B-cell maturation in memory B cells at the expense of plasma cells
19916746 Recombinant human interleukin-24 suppresses gastric carcinoma cell growth in vitro and in vivo.
19802007 Data show that JAK1/STAT-activating ligands, interleukin 10, IL20, IL24, and IL6 were expressed by senescent cells, supporting autocrine/paracrine activation of JAK1/STAT.
19734147 structural basis of IL-24 activity
19666410 Complete mda-7/IL-24 receptors (IL-22R1/IL-20R2 and IL-20R1/IL-20R2) are seldom expressed in liver cancer cell lines.
19535621 IL-24 expression is increased in inflamed mucosa of patients with inflammatory bowel disease. Colonic subepithelial myofibroblasts are a major local source of IL-24.
19276652 Current understanding of the molecular and biochemical basis of mda-7/IL-24 antitumor properties showed potential as a viable gene-based therapy for a wide spectrum of primary and advanced cancers.
19087313 Observational study of gene-disease association. (HuGE Navigator)
19056673 IL-24 overcomes temozolomide resistance and enhances cell death by down-regulation of O6-methylguanine-DNA methyltransferase in human melanoma cells
18941194 The addition of recombinant IL-24 to IL-2-activated chronic lymphocytic leukemia B cells results in increases of transcription, protein synthesis. and phosphorylation of p53.
18842498 Adenovirus vector expressing mda-7 selectively kills hepatocellular carcinoma cell line Hep3B.
18723497 vectors targeting the ER (Ad-ER-mda7) may be more effective in cancer gene therapy possibly through more effective induction or ER stress pathways
18704311 IL-24 produced by maternal-fetal interface in human first trimester pregnancy may influence the invasion of trophoblasts and is involved in normal pregnancy.
18599461 MDA-7/IL-24 protein induces stabilization of its own mRNA without activating its promoter. Furthermore, this posttranscriptional effect depends on de novo protein synthesis
18511292 MDA7/IL-24 is the key cytokine to trigger the up-regulation of class I interferons.
18376144 MDA-7/IL-24 plus radiation enhance survival in animals with intracranial primary human GBM tumors
18281516 Regulation of GST-MDA-7 toxicity in human glioblastoma cells by ERBB1, ERK1/2, PI3K, and JNK1-3 pathway signaling.
18281515 GST-MDA-7 induces an endoplasmic reticulum stress response that is causal in the activation of multiple proapoptotic pathways.
18278464 MDA-7/IL-24 has a role in inducing growth suppression and apoptosis of hepatoma
18061474 Both IL-20 and IL-24 showed correlations to CCL2/MCP-1 in plasma from rheumatoid arthritis and spondyloarthropathy patients.
18025283 These findings confirm that mda-7/IL-24 is a potent multidrug resistance (MDR) reversal agent, preferentially causing apoptosis in P-gp-overexpressing MDR cells.
17828282 MDA-7/IL-24 is ubiquitinated and degraded by the 26S proteasome
17703412 Observational study of gene-disease association. (HuGE Navigator)
17627414 injection of adenovirus GFP/IL-24 significantly suppressed in vivo hepatocellular carcinoma growth in athymic nude mice
17305874 Observational study of gene-disease association. (HuGE Navigator)
17305874 polymorphisms investigated are not associated with chronic periodontitis
17263806 Observational study of gene-disease association. (HuGE Navigator)
17263806 extended haplotype analysis revealed an association of IL19/IL20 haplotype GACACCGGAA with a higher risk for palmoplantar pustulosis (PPP) and of IL20/IL24 haplotype CAAAC with a reduced risk for PPP
17178890 Establish MDA-7/IL-24 and GADD45alpha and GADD45gamma as critical mediators of apoptosis and growth arrest in response to NSAIDs in cancer cells.
17178884 IL-24 glycosylation is not mandatory for inducing cell death or bystander activities in different cancer cells.
17083366 IL-19, IL-20 and IL-24 are distinct from classical ILs and constitute a separate subfamily of mediators within the IL-10 family
16912197 discriminating antitumor activity of MDA-7/IL-24 by presenting an unparalleled opportunity to develop improved therapeutic versions of this cancer-specific apoptosis-inducing cytokine.
16264231 IL-24 is a member of IL-10 family of cytokines, and it signals through two hetorodimeric receptors, whose expression is also upregulated by ras oncogenes
15851011 identification of a novel bystander mechanism of MDA-7 killing in pancreatic cancer that functions via IL-20 receptors
15815689 Observational study of gene-disease association. (HuGE Navigator)
15709189 MDA-7/IL-24 status was a significant prognostic factor in lung adenocarcinoma, not in lung squamous cell carcinoma.
15580305 Analysis of signal transduction changes in pancreatic carcinoma cells infected with Ad.mda-7 in combination with a ROS-inducer indicate that cell death correlates with modulation of discrete cassettes of multiple signaling pathways
15564140 MDA-7 induces dose-dependent cell death in melanoma tumor cells
15383566 MDA-7 synergizes with tumor necrosis factor (TNF) for NF-kappa B activation and for NF-kappa B-mediated gene expression and can suppress the apoptotic effects of TNF.
15334067 MDA-7/IL-24 has the ability to induce apoptosis in transformed cells, while having marginal growth suppressive effects on normal primary or immortalized cell lines.
15304100 mda-7s expression is linked to a non-metastatic phenotype
15273727 Adenovirua-mediatd mda7 sensitizes NSCLC cells to ionizing radiation by suppressing the activity of NHEJ, a pathway essential for repair of radiation-induced DSBs.
12907144 Ad-mda7 exhibits selectivity in apoptosis induction and growth suppression in an atypical smooth muscle cell line
12907143 in breast and lung tumor cells, MDA-7 protein expression modulates cell-cell adhesion and intracellular signaling via coordinate regulation of the beta-catenin and PI3K pathways
12811827 Signaling leading to susceptibility to MDA-7 induced apoptosis might be tyrosine kinase independent and can thus be distinguished from its cytokine function related properties mediated by IL-20/IL-22 receptor complexes requiring JAK/STAT kinase activity.
12606943 Melanoma differentiation associated gene-7, mda-7/IL-24, selectively induces growth suppression, apoptosis and radiosensitization in malignant gliomas in a p53-independent manner.
12533668 study demonstrate that expression of the MDA-7 tumor suppressor can negatively regulate iNOS expression in malignant melanoma cell lines
12395925 Review. mda-7 is a secreted protein with cytokine-like properties belonging to the IL-10 family. If delivered by an adenoviral vector, mda-7 induces selective apoptosis in cancer cells of diverse origin, while sparing their normal cellular counterparts.
12351624 examination of ligand/receptor interactions and in signal transduction that may lead to specificity and distinct biology
12085234 Inhibition of human lung cancer growth following adenovirus-mediated mda-7 gene expression in vivo.
12055212 Because blood leukocytes can be stimulated to produce MDA-7/IL-24, as well as respond to MDA-7/IL-24 by expressing secondary cytokines, MDA-7/IL-24 has the expression profile and major functional attributes that justify its designation as an interleukin.
11844832 downregulation of expression in primary melanomas facilitates progression to invasive and metastatic stages
11706020 these results provide compelling evidence for IL-24 being the fourth member of IL-10 family of cytokines to which their specific receptors have been identified.

AA Sequence

MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLW      1 - 70
EAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTL     71 - 140
ANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL        141 - 206
//

Text Mined References (123)

PMID Year Title
26977011 2016 IL24 and its Receptors Regulate Growth and Migration of Pancreatic Cancer Cells and Are Potential Biomarkers for IL24 Molecular Therapy.
26486636 2016 Modulation of CD4+ and CD8+ T-Cell Function by Interleukin 19 and Interleukin 24 During Filarial Infections.
26367324 2015 Interleukin-24 inhibits influenza A virus replication in vitro through induction of toll-like receptor 3 dependent apoptosis.
26168134 2014 IL-24 Induces Apoptosis via Upregulation of RNA-Activated Protein Kinase and Enhances Temozolomide-Induced Apoptosis in Glioma Cells.
26097559 2015 Targeting eradication of chronic myeloid leukemia using chimeric oncolytic adenovirus to drive IL-24 expression.
25778843 2015 Combination of IL-24 and cisplatin inhibits angiogenesis and lymphangiogenesis of cervical cancer xenografts in a nude mouse model by inhibiting VEGF, VEGF-C and PDGF-B.
25640309 2015 Systematic identification of molecular links between core and candidate genes in breast cancer.
25479732 2015 Adenovirus-mediated IL-24 confers radiosensitization to human lung adenocarcinoma in vitro and in vivo.
25236495 2014 MDA-7/IL-24 inhibits Nrf2-mediated antioxidant response through activation of p38 pathway and inhibition of ERK pathway involved in cancer cell apoptosis.
25178435 2015 Distribution of interleukin-10 family cytokines in serum and synovial fluid of patients with inflammatory arthritis reveals different contribution to systemic and joint inflammation.
25091574 2014 Melanoma differentiation-associated gene-7/interleukin-24 as a potential prognostic biomarker and second primary malignancy indicator in head and neck squamous cell carcinoma patients.
25001534 2014 MDA-7/IL-24: multifunctional cancer killing cytokine.
24552169 2014 IL-24 gene polymorphisms are associated with cardiometabolic parameters and cardiovascular risk factors but not with premature coronary artery disease: the genetics of atherosclerotic disease Mexican study.
24527982 2014 Expression of interleukin (IL)-19 and IL-24 in inflammatory bowel disease patients: a cross-sectional study.
24282278 2014 Novel mechanism of MDA-7/IL-24 cancer-specific apoptosis through SARI induction.
24270662 2014 Gene expression profiling of the leading edge of cutaneous squamous cell carcinoma: IL-24-driven MMP-7.
24211183 2013 Tumor necrosis factor receptor signaling in keratinocytes triggers interleukin-24-dependent psoriasis-like skin inflammation in mice.
24084981 2013 Interleukin-24 inhibits cell migration and invasion in the neuroblastoma cell line SH-SY5Y.
23988449 2013 Sigma 1 Receptor plays a prominent role in IL-24-induced cancer-specific apoptosis.
23982423 2013 Adenovirus-mediated IL-24 expression enhances the chemosensitivity of multidrug-resistantgastric cancer cells to cisplatin.
23772146 2013 Inhibitory effect of melanoma differentiation associated gene-7/interleukin-24 on invasion in vitro of human melanoma cancer cells.
23768573 2014 T cell-derived microvesicles induce mast cell production of IL-24: relevance to inflammatory skin diseases.
23722307 2013 MDA-7/IL-24 suppresses tumor adhesion and invasive potential in hepatocellular carcinoma cell lines.
23720015 2013 Targeting breast cancer-initiating/stem cells with melanoma differentiation-associated gene-7/interleukin-24.
23692552 2013 Interleukin-24 induces neuroblastoma SH-SY5Y cell differentiation, growth inhibition, and apoptosis by promoting ROS production.
23546515 2013 Potential implication of IL-24 in lymphangiogenesis of human breast cancer.
23468528 2013 mda-7/IL-24 expression inhibits breast cancer through upregulation of growth arrest-specific gene 3 (gas3) and disruption of ?1 integrin function.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23110359 Expression of IL-24 and IL-24 receptors in human wound tissues and the biological implications of IL-24 on keratinocytes.
23078624 2012 Critical role of lysine 123 in the ubiquitin-mediated degradation of MDA-7/IL-24.
23063979 2012 Interleukin-24 attenuates ?-glycerophosphate-induced calcification of vascular smooth muscle cells by inhibiting apoptosis, the expression of calcification and osteoblastic markers, and the Wnt/?-catenin pathway.
22917968 2012 Regulation of pro-inflammatory cytokines TNF? and IL24 by microRNA-203 in primary keratinocytes.
22475191 Expression of a murine homolog of apoptosis-inducing human IL-24/MDA-7 in murine tumors fails to induce apoptosis or produce anti-tumor effects.
22248086 2012 Enhanced apoptosis-inducing function of MDA-7/IL-24 RGD mutant via the increased adhesion to tumor cells.
21931671 2011 Combinatorial effect of non-steroidal anti-inflammatory drugs and NF-?B inhibitors in ovarian cancer therapy.
21922126 2011 Expression of interleukin-24 and its receptor in human pancreatic myofibroblasts.
21843952 2011 Splice variants of mda-7/IL-24 differentially affect survival and induce apoptosis in U2OS cells.
21787878 2011 Interleukin 24 as a novel potential cytokine immunotherapy for the treatment of Mycobacterium tuberculosis infection.
21732348 2012 mda-7/IL-24 differentially regulates soluble and nuclear clusterin in prostate cancer.
21524313 2011 Prostate transglutaminase (TGase-4) antagonizes the anti-tumour action of MDA-7/IL-24 in prostate cancer.
21448421 2011 Interleukin-24 is correlated with differentiation and lymph node numbers in rectal cancer.
21282359 2011 Novel functions for mda-7/IL-24 and IL-24 delE5: regulation of differentiation of acute myeloid leukemic cells.
21109977 2011 mda-7/IL-24 induces apoptosis in human GBC-SD gallbladder carcinoma cells via mitochondrial apoptotic pathway.
20976276 2010 Interleukin-10 (IL-10) pathway: genetic variants and outcomes of HIV-1 infection in African American adolescents.
20962850 2011 A targeted association study in systemic lupus erythematosus identifies multiple susceptibility alleles.
20858700 2010 Melanoma differentiation associated gene-7/interleukin-24 potently induces apoptosis in human myeloid leukemia cells through a process regulated by endoplasmic reticulum stress.
20545760 2010 IL-24 is expressed during wound repair and inhibits TGFalpha-induced migration and proliferation of keratinocytes.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20501829 2010 Mechanism by which Mcl-1 regulates cancer-specific apoptosis triggered by mda-7/IL-24, an IL-10-related cytokine.
20406981 2010 Mechanism of autophagy to apoptosis switch triggered in prostate cancer cells by antitumor cytokine melanoma differentiation-associated gene 7/interleukin-24.
20383178 2010 HDAC4 inhibits the transcriptional activation of mda-7/IL-24 induced by Sp1.
20216471 2011 IL-24 gene transfer sensitizes melanoma cells to erlotinib through modulation of the Apaf-1 and Akt signaling pathways.
20189296 2010 Enhanced anti-tumor activity by the combination of a conditionally replicating adenovirus mediated interleukin-24 and dacarbazine against melanoma cells via induction of apoptosis.
20187794 2010 The in vitro and in vivo antitumor activity of adenovirus-mediated interleukin-24 expression for laryngocarcinoma.
20179672 2010 Inhibition of multiple protective signaling pathways and Ad.5/3 delivery enhances mda-7/IL-24 therapy of malignant glioma.
20163249 2010 Double-regulated oncolytic adenovirus-mediated interleukin-24 overexpression exhibits potent antitumor activity on gastric adenocarcinoma.
20103619 2010 PERK-dependent regulation of ceramide synthase 6 and thioredoxin play a key role in mda-7/IL-24-induced killing of primary human glioblastoma multiforme cells.
20072629 2010 The p38 MAPK regulates IL-24 expression by stabilization of the 3' UTR of IL-24 mRNA.
20061404 2010 IL-24 transgenic mice: in vivo evidence of overlapping functions for IL-20, IL-22, and IL-24 in the epidermis.
19965640 2010 Interleukin-24 inhibits the plasma cell differentiation program in human germinal center B cells.
19916746 2010 Recombinant human interleukin-24 suppresses gastric carcinoma cell growth in vitro and in vivo.
19802007 2010 Cytokine expression and signaling in drug-induced cellular senescence.
19734147 2009 Structural mapping of post-translational modifications in human interleukin-24: role of N-linked glycosylation and disulfide bonds in secretion and activity.
19666410 2009 Expression pattern of mda-7/IL-24 receptors in liver cancer cell lines.
19535621 2009 Expression of IL-24, an activator of the JAK1/STAT3/SOCS3 cascade, is enhanced in inflammatory bowel disease.
19276652 2009 Historical perspective and recent insights into our understanding of the molecular and biochemical basis of the antitumor properties of mda-7/IL-24.
19087313 2008 Polymorphisms in the interleukin-10 gene cluster are possibly involved in the increased risk for major depressive disorder.
19056673 2008 Interleukin-24 overcomes temozolomide resistance and enhances cell death by down-regulation of O6-methylguanine-DNA methyltransferase in human melanoma cells.
18941194 2008 IL-24 induces apoptosis of chronic lymphocytic leukemia B cells engaged into the cell cycle through dephosphorylation of STAT3 and stabilization of p53 expression.
18842498 2008 Adenovirus vector expressing mda-7 selectively kills hepatocellular carcinoma cell line Hep3B.
18723497 2008 Adenoviral endoplasmic reticulum-targeted mda-7/interleukin-24 vector enhances human cancer cell killing.
18704311 2008 IL-24 expression at maternal-fetal interface and its roles in trophoblast invasion.
18599461 2008 Autocrine regulation of mda-7/IL-24 mediates cancer-specific apoptosis.
18511292 2008 Killing of human melanoma cells induced by activation of class I interferon-regulated signaling pathways via MDA-7/IL-24.
18376144 2008 MDA-7/IL-24 plus radiation enhance survival in animals with intracranial primary human GBM tumors.
18281516 2008 Regulation of GST-MDA-7 toxicity in human glioblastoma cells by ERBB1, ERK1/2, PI3K, and JNK1-3 pathway signaling.
18281515 2008 Caspase-, cathepsin-, and PERK-dependent regulation of MDA-7/IL-24-induced cell killing in primary human glioma cells.
18278464 2008 Replication-incompetent adenovirus vector-mediated MDA-7/IL-24 selectively induces growth suppression and apoptosis of hepatoma cell Line SMMC-7721.
18061474 2008 The expression of IL-20 and IL-24 and their shared receptors are increased in rheumatoid arthritis and spondyloarthropathy.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18025283 2007 Melanoma differentiation associated gene-7/interleukin-24 reverses multidrug resistance in human colorectal cancer cells.
17828282 2008 MDA-7/IL-24, a novel tumor suppressor/cytokine is ubiquitinated and regulated by the ubiquitin-proteasome system, and inhibition of MDA-7/IL-24 degradation enhances the antitumor activity.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17627414 2007 Adenovirus-mediated Il-24 expression suppresses hepatocellular carcinoma growth via induction of cell apoptosis and cycling arrest and reduction of angiogenesis.
17305874 2007 Interleukin-24, RANTES and CCR5 gene polymorphisms are not associated with chronic adult periodontitis.
17263806 2007 Association analysis of IL19, IL20 and IL24 genes in palmoplantar pustulosis.
17178890 2006 A novel pathway involving melanoma differentiation associated gene-7/interleukin-24 mediates nonsteroidal anti-inflammatory drug-induced apoptosis and growth arrest of cancer cells.
17178884 2006 N-glycosylation of MDA-7/IL-24 is dispensable for tumor cell-specific apoptosis and "bystander" antitumor activity.
17083366 2006 Interleukin (IL)-19, IL-20 and IL-24 are produced by and act on keratinocytes and are distinct from classical ILs.
16912197 2006 BiP/GRP78 is an intracellular target for MDA-7/IL-24 induction of cancer-specific apoptosis.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16313301 2005 Alternative splicing of IL-24 in melanocytes by deletion of exons 3 and 5.
16264231 2006 Identification by differential display of IL-24 autocrine loop activated by ras oncogenes.
15851011 2005 mda-7/IL24 kills pancreatic cancer cells by inhibition of the Wnt/PI3K signaling pathways: identification of IL-20 receptor-mediated bystander activity against pancreatic cancer.
15815689 2005 Single nucleotide polymorphisms and haplotypes in the IL10 region associated with HCV clearance.
15709189 2005 Expression of MDA-7/IL-24 and its clinical significance in resected non-small cell lung cancer.
15580305 2005 Induction of reactive oxygen species renders mutant and wild-type K-ras pancreatic carcinoma cells susceptible to Ad.mda-7-induced apoptosis.
15564140 2004 Bystander activity of Ad-mda7: human MDA-7 protein kills melanoma cells via an IL-20 receptor-dependent but STAT3-independent mechanism.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383566 2004 Melanoma differentiation-associated gene-7/IL-24 gene enhances NF-kappa B activation and suppresses apoptosis induced by TNF.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15334067 2004 Mechanistic aspects of mda-7/IL-24 cancer cell selectivity analysed via a bacterial fusion protein.
15304100 2004 Loss of novel mda-7 splice variant (mda-7s) expression is associated with metastatic melanoma.
15273727 2004 Adenoviral-mediated mda-7 expression suppresses DNA repair capacity and radiosensitizes non-small-cell lung cancer cells.
12907144 2003 Tumor suppressor MDA-7/IL-24 selectively inhibits vascular smooth muscle cell growth and migration.
12907143 2003 MDA-7 negatively regulates the beta-catenin and PI3K signaling pathways in breast and lung tumor cells.
12811827 2003 Mda-7/IL-24 induces apoptosis of diverse cancer cell lines through JAK/STAT-independent pathways.
12606943 2003 Melanoma differentiation associated gene-7, mda-7/IL-24, selectively induces growth suppression, apoptosis and radiosensitization in malignant gliomas in a p53-independent manner.
12533668 2003 Negative association of melanoma differentiation-associated gene (mda-7) and inducible nitric oxide synthase (iNOS) in human melanoma: MDA-7 regulates iNOS expression in melanoma cells.
12485618 2003 MDA-7/IL-24: novel cancer growth suppressing and apoptosis inducing cytokine.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12395925 2002 mda-7 (IL-24): signaling and functional roles.
12351624 2002 Interleukins 19, 20, and 24 signal through two distinct receptor complexes. Differences in receptor-ligand interactions mediate unique biological functions.
12182458 2002 IL-24 is expressed by rat and human macrophages.
12114539 2002 mda-7 (IL-24) Mediates selective apoptosis in human melanoma cells by inducing the coordinated overexpression of the GADD family of genes by means of p38 MAPK.
11706020 2002 Interleukin 24 (MDA-7/MOB-5) signals through two heterodimeric receptors, IL-22R1/IL-20R2 and IL-20R1/IL-20R2.
11704829 2001 Genomic structure, chromosomal localization and expression profile of a novel melanoma differentiation associated (mda-7) gene with cancer specific growth suppressing and apoptosis inducing properties.
11163236 2001 Interleukin 20: discovery, receptor identification, and role in epidermal function.
10942517 2000 AP-1 and C/EBP transcription factors contribute to mda-7 gene promoter activity during human melanoma differentiation.
9826712 1998 The cancer growth suppressor gene mda-7 selectively induces apoptosis in human breast cancer cells and inhibits tumor growth in nude mice.
8799171 1996 The melanoma differentiation associated gene mda-7 suppresses cancer cell growth.
8545104 1995 Subtraction hybridization identifies a novel melanoma differentiation associated gene, mda-7, modulated during human melanoma differentiation, growth and progression.