| Tbio | Interleukin-22 receptor subunit alpha-2 |
Isoform 1 may play a role in establishing and maintaining successful pregnancy.
This gene encodes a member of the class II cytokine receptor family. The encoded soluble protein specifically binds to and inhibits interleukin 22 activity by blocking the interaction of interleukin 22 with its cell surface receptor. The encoded protein may be important in the regulation of inflammatory response, and has been implicated in the regulation of tumorigenesis in the colon. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2013]
This gene encodes a member of the class II cytokine receptor family. The encoded soluble protein specifically binds to and inhibits interleukin 22 activity by blocking the interaction of interleukin 22 with its cell surface receptor. The encoded protein may be important in the regulation of inflammatory response, and has been implicated in the regulation of tumorigenesis in the colon. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2013]
Comments
| Disease | Target Count | P-value |
|---|---|---|
| psoriasis | 6685 | 1.5e-13 |
| non primary Sjogren syndrome sicca | 840 | 1.9e-02 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Multiple Sclerosis | 498 | 0.0 | 2.0 |
| Disease | log2 FC | p |
|---|---|---|
| non primary Sjogren syndrome sicca | -1.100 | 1.9e-02 |
| psoriasis | 1.100 | 1.5e-13 |
| PMID | Text | |
|---|---|---|
| 21041731 | Through a combined approach including genetic and immunological investigation in an animal model and large-scale association studies of patients with multiple sclerosis (MS), IL-22RA2 is established as an MS risk gene. | |
| 20237496 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19926456 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19393422 | Polymorphisms in IL22RA1 are associated with severe CRS. | |
| 19285080 | Comparison of IL-22/IL-22BP and IL-22/IL-22R1 crystal structures shows that both receptors display an overlapping IL-22 binding surface, which is consistent with the inhibitory role played by IL-22 binding protein. | |
| 19240061 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19193995 | Crystallization and preliminary X-ray diffraction results of the IL-22-IL-22 binding protein (IL-22BP) complex are described. | |
| 18675824 | The IL-22R and IL-10R2 binding sites are juxtaposed on adjacent IL-22 surfaces contributed mostly by helices A, D, and F and loop AB. |
MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIMFSC 1 - 70 SMKSSHQKPSGCWQHISCNFPGCRTLAKYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASA 71 - 140 GSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINN 141 - 210 SLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP 211 - 263 //
| PMID | Year | Title | |
|---|---|---|---|
| 21833088 | 2011 | Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis. | |
| 21041731 | 2010 | IL-22RA2 associates with multiple sclerosis and macrophage effector mechanisms in experimental neuroinflammation. | |
| 20237496 | 2010 | New genetic associations detected in a host response study to hepatitis B vaccine. | |
| 19926456 | 2010 | Further association analysis of chr 6q22-24 suggests a role of IL-20RA polymorphisms in psoriasis. | |
| 19393422 | 2009 | Polymorphisms in the interleukin-22 receptor alpha-1 gene are associated with severe chronic rhinosinusitis. | |
| 19285080 | 2009 | Crystal structure of a soluble decoy receptor IL-22BP bound to interleukin-22. | |
| 19240061 | 2009 | Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling. | |
| 19193995 | 2009 | Crystallization and preliminary X-ray diffraction analysis of human IL-22 bound to its soluble decoy receptor IL-22BP. | |
| 18675824 | 2008 | IL-22R, IL-10R2, and IL-22BP binding sites are topologically juxtaposed on adjacent and overlapping surfaces of IL-22. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 15340161 | 2004 | Signal peptide prediction based on analysis of experimentally verified cleavage sites. | |
| 15201862 | 2004 | Cloning of murine IL-22 receptor alpha 2 and comparison with its human counterpart. | |
| 14574404 | 2003 | The DNA sequence and analysis of human chromosome 6. | |
| 12975309 | 2003 | The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. | |
| 12700595 | 2003 | Cloning and characterization of mouse IL-22 binding protein. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 11607789 | 2001 | A novel, soluble homologue of the human IL-10 receptor with preferential expression in placenta. | |
| 11481447 | 2001 | A soluble class II cytokine receptor, IL-22RA2, is a naturally occurring IL-22 antagonist. | |
| 11390454 | 2001 | Identification, cloning, and characterization of a novel soluble receptor that binds IL-22 and neutralizes its activity. | |
| 11390453 | 2001 | Cloning and characterization of IL-22 binding protein, a natural antagonist of IL-10-related T cell-derived inducible factor/IL-22. |
