Property Summary

NCBI Gene PubMed Count 50
PubMed Score 75.97
PubTator Score 64.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 1.200 3.2e-04
cutaneous lupus erythematosus 1.200 4.1e-02
psoriasis 2.100 5.7e-89
osteosarcoma -2.142 6.9e-06
tuberculosis -2.100 1.5e-09
interstitial cystitis 2.100 6.1e-04
primary Sjogren syndrome 1.200 5.6e-03
lung adenocarcinoma 1.100 5.2e-05
ductal carcinoma in situ 1.100 2.7e-02
invasive ductal carcinoma 1.700 1.2e-03
ulcerative colitis 1.100 9.4e-03
head and neck cancer and chronic obstruc... 1.100 4.5e-03

 GWAS Trait (1)

Gene RIF (43)

PMID Text
25941256 STAT3 signaling downstream of IL-23R and IL-21R has a role in controlling human mucosal-associated invariant T cells and NKT cell numbers
25647271 expression of IL-21 and IL-21R were up-regulated in autoimmune thyroid disease and may be involved in the pathogenesis of the disease through augmenting aberrant immune cascade
25500255 IL-21/IL-21R could act as potential biomarkers presenting early systemic sclerosis skin lesions severity.
25398835 interleukin-21 receptor deficiency is associated with Severe Combined Immunodeficiency.
25007029 IL-21R on B cells is upregulated in allergic rhinitis patients when compared to controls. IL-21/IL-21R may be involved in the regulation of allergic reactions through the inhibition of IgE.
24728504 Human neutrophils in peripheral blood express functional IL-21 receptors.
23830147 The IL-21R/STAT3 pathway is required for many aspects of human CD8(+) T-cell behavior but in some cases can be compensated by other signals.
23440042 human IL-21R deficiency causes an immunodeficiency and highlights the need for early diagnosis
23396946 Human monocyte-like THP-1 cells express two IL-21 receptor components, CD132 (gammac) and IL-21Ralpha, on their cell surface, as assessed by flow cytometry.
23354321 Data suggest that IL21 rs2221903 and IL21R rs3093301 polymorphisms may, independently or interactively, affect the susceptibility to and/or persistence of HBV infection potentially through altering IL-21 and IgE production.
23296193 IL-21R gene polymorphisms and serum IL-21 levels predict virological response to interferon-based therapy in Asian chronic hepatitis C patients.
23098230 Abundant expression of interleukin-21 receptor in follicular lymphoma cells is associated with more aggressive disease.
22235133 Crystal structure of IL-21 binding to IL-21R reveals that the WSXWS motif of IL-21R is C-mannosylated at the first tryptophan.
22032620 For risk-factor studies, anti-citrullinated peptide antibody-positive (CCP)-negative rheumatoid arthritis patients can be studied as one group via measurement of their IL-21 and IL-21 receptor levels.
21531891 Data suggest that the association of 2009 H1N1 vaccine-induced Ab responses with IL-21/IL-21R upregulation and with development of memory B cells and plasmablasts has implications for future research in vaccine design.
21524651 IL21R and vezatin were also cleaved in apoptotic HeLa cells with the cleavage sites Asp344, Asp655 and Asp53.
21281812 These findings suggest role(s) for IL-21 in both the acute and chronic stages of multiple sclerosis via direct effects on T and B lymphocytes and, demonstrated for the first time, also on neurons.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
20193734 IL-21R is expressed in follicular lymphoma cells from early diagnosed, untreated patients. It mediates apoptosis. It is heterogenously expressed by human FL cell lines bearing the t(14;18) translocation.
20072140 Observational study of gene-disease association. (HuGE Navigator)
20059963 This report provides the first evidence that WSB-2 is a regulator of IL-21R expression and IL-21-induced signal transduction.
19874204 parathyroid hormone (PTH) and interleukin 21 receptor (IL21R), achieved consistent association results for bone mineral density in both discovery and replication samples.
19874204 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19644854 A polymorphism within IL21R confers risk for systemic lupus erythematosus.
19644854 Observational study of gene-disease association. (HuGE Navigator)
19617351 Tax1 transactivates the interleukin-21 (IL-21) and its receptor (IL-21R) genes in human T-cells.
19322899 Increased IL-21R is associated with inflammatory bowel disease.
19230867 analyzed the transcriptional differences between B-cell subsets by gene expression profiling, and identified 15 genes significantly correlated to survival/proliferation. Among them, IL-21R and TCL1 were highly expressed in naive B cells.
19075398 These results suggest an important role for IL-21R in the mobilization of skin dendritic cells to draining lymph nodes and the subsequent allergic response to epicutaneously introduced antigen.
17624663 Follicular lymphoma cells showed exceptionally high IL-21R expression. IL-21 induced apoptosis in follicular lymphoma cells expressing high levels of IL-21 receptor.
17462506 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17462506 Data suggest a contribution of IL21 and IL21R to genetic susceptibility to type 1 diabetes and possible involvement of IL-21 and its receptor system in the disease pathogenesis.
17032244 IL-21R is overexpressed in the inflamed synovial membrane and in peripheral blood or synovial fluid leukocytes of RA patients. Thus, blockade of IL-21R signalling pathway may have a therapeutic potential in acute RA patients.
17015683 IL-21 differentially regulates IL-4-induced IgE production, via its growth- and differentiation-promoting capacities on isotype- committed B cells, & via its ability to induce IFNg production; the outcome depends on the presence of a IL-21R polymorphism.
16867043 Observational study of gene-disease association. (HuGE Navigator)
16391014 surface IL-21 receptor is expressed at variable levels by chronic lymphocytic leukemia B cells
16260592 TCR-induced IL-21R expression is driven by TCR-mediated augmentation of Sp1 protein levels and may partly depend on the dephosphorylation of Sp1
15751077 The up-regulation of IL-21R in keratinocytes indicates that its expression pattern is not only altered but it appears to be independent of key cytokines that are operant in systemic scleosis.
15146416 IL-21R is associated with the activated phenotype of rheumatoid arthritis synovial fibroblasts independently of the major proinflammatory cytokines IL-1beta and TNFalpha, but not with the destruction of articular cartilage and bone.
12700598 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRS      1 - 70
AHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRS     71 - 140
DYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSY    141 - 210
QGTWSEWSDPVIFQTQSEELKEGWNPHLLLLLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFMPL    211 - 280
YKGCSGDFKKWVGAPFTGSSLELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPS    281 - 350
FWPTAQNSGGSAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLD    351 - 420
AGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGSPLAGLDMDTF    421 - 490
DSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS                          491 - 538
//

Text Mined References (52)

PMID Year Title
25941256 2015 STAT3 is a critical cell-intrinsic regulator of human unconventional T cell numbers and function.
25647271 2015 Increased IL-21/IL-21R expression and its proinflammatory effects in autoimmune thyroid disease.
25500255 2015 The elevated expression of Th17-related cytokines and receptors is associated with skin lesion severity in early systemic sclerosis.
25398835 2015 Extending the clinical and immunological phenotype of human interleukin-21 receptor deficiency.
25007029 2015 Upregulated interleukin-21 receptor on B cells associated with the downregulation of IgE in patients with allergic rhinitis.
24728504 2014 Human peripheral neutrophils express functional IL-21 receptors.
23830147 2013 Signal transducer and activator of transcription 3 (STAT3) mutations underlying autosomal dominant hyper-IgE syndrome impair human CD8(+) T-cell memory formation and function.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23440042 2013 Loss-of-function mutations in the IL-21 receptor gene cause a primary immunodeficiency syndrome.
23396946 2013 IL-21 enhances phagocytosis in mononuclear phagocyte cells: identification of spleen tyrosine kinase as a novel molecular target of IL-21.
23354321 2013 IL21 and IL21R polymorphisms and their interactive effects on serum IL-21 and IgE levels in patients with chronic hepatitis B virus infection.
23296193 2013 IL-21R gene polymorphisms and serum IL-21 levels predict virological response to interferon-based therapy in Asian chronic hepatitis C patients.
23098230 2013 Abundant expression of interleukin-21 receptor in follicular lymphoma cells is associated with more aggressive disease.
22235133 2012 Crystal structure of interleukin-21 receptor (IL-21R) bound to IL-21 reveals that sugar chain interacting with WSXWS motif is integral part of IL-21R.
22032620 2011 Can anti-cyclic citrullinated peptide antibody-negative RA be subdivided into clinical subphenotypes?
21531891 2011 Upregulation of IL-21 receptor on B cells and IL-21 secretion distinguishes novel 2009 H1N1 vaccine responders from nonresponders among HIV-infected persons on combination antiretroviral therapy.
21524651 2011 Caspase-8 cleavage of the interleukin-21 (IL-21) receptor is a negative feedback regulator of IL-21 signaling.
21281812 2011 IL-21 and IL-21 receptor expression in lymphocytes and neurons in multiple sclerosis brain.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
20193734 2010 Heterogeneous expression and function of IL-21R and susceptibility to IL-21-mediated apoptosis in follicular lymphoma cells.
20072140 2010 RGMA and IL21R show association with experimental inflammation and multiple sclerosis.
20059963 2010 Regulation of interleukin-21 receptor expression and its signal transduction by WSB-2.
19874204 2010 IL21R and PTH may underlie variation of femoral neck bone mineral density as revealed by a genome-wide association study.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19644854 2009 A polymorphism within IL21R confers risk for systemic lupus erythematosus.
19617351 2009 Transcriptional activation of the interleukin-21 gene and its receptor gene by human T-cell leukemia virus type 1 Tax in human T-cells.
19322899 2009 Il-21 enhances NK cell activation and cytolytic activity and induces Th17 cell differentiation in inflammatory bowel disease.
19230867 2009 Distinct response in maintenance of human naive and memory B cells via IL-21 receptor and TCL1/Akt pathways.
19075398 2009 IL-21R is essential for epicutaneous sensitization and allergic skin inflammation in humans and mice.
17624663 2007 High IL-21 receptor expression and apoptosis induction by IL-21 in follicular lymphoma.
17462506 2007 Molecular scanning of interleukin-21 gene and genetic susceptibility to type 1 diabetes.
17032244 2006 Interleukin-21 induces T-cell activation and proinflammatory cytokine secretion in rheumatoid arthritis.
17015683 2006 IFN-gamma-mediated inhibition of human IgE synthesis by IL-21 is associated with a polymorphism in the IL-21R gene.
16867043 2006 IL-10 promoter and IL4-Ralpha gene SNPs are associated with immediate beta-lactam allergy in atopic women.
16391014 2006 Interleukin-21 receptor (IL-21R) is up-regulated by CD40 triggering and mediates proapoptotic signals in chronic lymphocytic leukemia B cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16260592 2005 Interleukin-21 receptor gene induction in human T cells is mediated by T-cell receptor-induced Sp1 activity.
15751077 2005 Expression of interleukin-21 receptor in epidermis from patients with systemic sclerosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15146416 2004 Expression of interleukin-21 receptor, but not interleukin-21, in synovial fibroblasts and synovial macrophages of patients with rheumatoid arthritis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12700598 2003 Novel genetic variation of human interleukin-21 receptor is associated with elevated IgE levels in females.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11821949 2002 The gene for interleukin-21 receptor is the partner of BCL6 in t(3;16)(q27;p11), which is recurrently observed in diffuse large B-cell lymphoma.
11418623 2001 Cutting edge: the common gamma-chain is an indispensable subunit of the IL-21 receptor complex.
11081504 2000 Interleukin 21 and its receptor are involved in NK cell expansion and regulation of lymphocyte function.
11016959 2000 Cloning of a type I cytokine receptor most related to the IL-2 receptor beta chain.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.