Property Summary

NCBI Gene PubMed Count 20
PubMed Score 34.98
PubTator Score 15.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
chronic rhinosinusitis 1.063 4.0e-02
cystic fibrosis and chronic rhinosinusit... 1.364 8.0e-03
group 3 medulloblastoma 1.100 5.0e-04
lung adenocarcinoma 1.700 7.2e-04
nasopharyngeal carcinoma -1.200 9.0e-04
non-small cell lung cancer 2.161 1.3e-08
pancreatic cancer 1.300 2.2e-03

Protein-protein Interaction (11)

Gene RIF (7)

AA Sequence

MQTFTMVLEEIWTSLFMWFFYALIPCLLTDEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEY      1 - 70
QGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTR     71 - 140
PGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVK    141 - 210
AIGRYSAFSQTECVEVQGEAIPLVLALFAFVGFMLILVVVPLFVWKMGRLLQYSCCPVVVLPDTLKITNS    211 - 280
PQKLISCRREEVDACATAVMSPEELLRAWIS                                           281 - 311
//

Text Mined References (22)

PMID Year Title