Property Summary

NCBI Gene PubMed Count 20
PubMed Score 35.49
PubTator Score 15.36

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
non-small cell lung cancer 2.161 1.3e-08
pancreatic cancer 1.300 2.2e-03
group 3 medulloblastoma 1.100 5.0e-04
lung adenocarcinoma 1.700 7.2e-04
nasopharyngeal carcinoma -1.200 9.0e-04
chronic rhinosinusitis 1.063 4.0e-02
cystic fibrosis and chronic rhinosinusit... 1.364 8.0e-03

Protein-protein Interaction (10)

Gene RIF (7)

PMID Text
24455976 Trabecular meshwork cells express IL-20 receptors; Mutation of the T104 residue in IL-20R2 leads to a reduction in STAT3 phosphorylation as well as decreased matrix metalloproteinase activity
22802649 The crystal structure of the IL-20/IL-20R1/IL-20R2 complex reveals how type I and II complexes discriminate cognate from noncognate ligands
22232181 crystallographic asymmetric unit contains one IL-20-IL-20R1-IL-20R2 complex, corresponding to a solvent content of approximately 54%
19666410 Complete mda-7/IL-24 receptors (IL-22R1/IL-20R2 and IL-20R1/IL-20R2) are seldom expressed in liver cancer cell lines.
18480827 The hypotheses that genetic variations of the IL-20-RI influence susceptibility to psoriasis and single nucleotide polymorphisms (SNPs) in the IL20RA and IL20RB genes in psoriasis patients were investigated.
18480827 Observational study of gene-disease association. (HuGE Navigator)
14580208 forms stable complex with interleukin-19 and interleukin-20 [IL-20R1][IL-20R2]

AA Sequence

MQTFTMVLEEIWTSLFMWFFYALIPCLLTDEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEY      1 - 70
QGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTR     71 - 140
PGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVK    141 - 210
AIGRYSAFSQTECVEVQGEAIPLVLALFAFVGFMLILVVVPLFVWKMGRLLQYSCCPVVVLPDTLKITNS    211 - 280
PQKLISCRREEVDACATAVMSPEELLRAWIS                                           281 - 311
//

Text Mined References (22)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24455976 Interleukin-20 receptor expression in the trabecular meshwork and its implication in glaucoma.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24047446 2013 Genome-wide association study of co-occurring anxiety in major depression.
22802649 2012 Structural basis for receptor sharing and activation by interleukin-20 receptor-2 (IL-20R2) binding cytokines.
22232181 2012 Purification, crystallization and preliminary X-ray diffraction analysis of the IL-20-IL-20R1-IL-20R2 complex.
19666410 2009 Expression pattern of mda-7/IL-24 receptors in liver cancer cell lines.
19043545 2008 Genetics meets metabolomics: a genome-wide association study of metabolite profiles in human serum.
18480827 2008 Association analysis of IL20RA and IL20RB genes in psoriasis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16703417 2006 IL-20: biological functions and clinical implications.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14580208 2003 Characterization of the recombinant extracellular domains of human interleukin-20 receptors and their complexes with interleukin-19 and interleukin-20.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12351624 2002 Interleukins 19, 20, and 24 signal through two distinct receptor complexes. Differences in receptor-ligand interactions mediate unique biological functions.
11564763 2001 Cutting edge: STAT activation by IL-19, IL-20 and mda-7 through IL-20 receptor complexes of two types.
11181995 2001 The sequence of the human genome.
11163236 2001 Interleukin 20: discovery, receptor identification, and role in epidermal function.