Property Summary

NCBI Gene PubMed Count 65
PubMed Score 0.07
PubTator Score 70.25

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer 1.100 2.7e-03
medulloblastoma, large-cell 1.100 2.2e-03
ovarian cancer -1.100 2.3e-04
psoriasis 1.100 5.3e-26

Gene RIF (60)

AA Sequence

MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTES      1 - 70
LQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMK     71 - 140
KYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE                                      141 - 176
//

Text Mined References (67)

PMID Year Title