Property Summary

NCBI Gene PubMed Count 61
PubMed Score 0.07
PubTator Score 70.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Gene RIF (56)

PMID Text
26404542 Data show reduced cytokines IL-10 and IL-19 expression, and enhanced IL-20 and il-1 beta expression in chronic recurrent multifocal osteomyelitis (CRMO) monocytes.
26354610 Coincident diabetes mellitus type 2 in either pulmonary or latent tuberculosis is characterized by decreased production of the IL-20 subfamily of cytokines.
25631632 IL-20 serum levels were increased in patients with active multiple myeloma compared to both healthy controls and responders to bortezomib-based treatment.IL-20 participate actively in the pathophysiology of multiple myeloma progression.
25543042 IL-20 may play a patho-physiologic role in the Th2 immune response in human asthma and may be a potential biomarker of asthma severity.
25178435 Distribution of interleukin-10 family cytokines in serum and synovial fluid of patients with inflammatory arthritis reveals different
25028099 Overexpression of IL-20 was detected in the airway epithelium collected from patients with asthma.
24628979 IL-20 is produced by keratinocytes, released into the epidermis and then possibly taken up by papillary mononuclear cells
24470401 Decreased interleukin-20 expression in scleroderma skin contributes to cutaneous fibrosis.
23892591 This study demonstrates that rs1713239 and infection may have potential synergetic effect on modulating the transcriptional activity of IL-20.
23812620 We observed that IL-20 which is an IL-10 group angiogenesis indicator was suppressed in systemic sclerosis, suggesting abnormal angiogenesis.
23271730 Interleukin-20 promotes migration of bladder cancer cells through extracellular signal-regulated kinase (ERK)-mediated MMP-9 protein expression leading to nuclear factor (NF-kappaB) activation by inducing the up-regulation of p21(WAF1) protein expression
23207823 IL-10-- and IL-20--expressing epithelial and inflammatory cells are increased in patients with ulcerative colitis.
23183096 the GG genotypes of the IL-20 polymorphisms (rs2981573 and rs2232360) might have an important role in the development of UC in the Mexican population.
23000500 A significant association was found between the combined genotypes of IL19GC + CC and IL20TG + GG and increased risk of vesicoureteral reflux.
22962576 Elevated expression of inflammatory cytokines (IL-5, IL-20, and IL-28A) is associated with bladder cancer development.
22948742 A blood test for discrimination of patients with acute cellular rejection from transplanted kidney is based on simultaneous quantification of three analytes: IL-1 receptor antagonist, IL-20 and soluble CD40 ligand.
22930279 The mRNA levels of p40, IL-20 and IL-21 at baseline may serve as potential predictors of treatment response to ustekinumab treatment in psoriasis.
22232181 crystallographic asymmetric unit contains one IL-20-IL-20R1-IL-20R2 complex, corresponding to a solvent content of approximately 54%
21565488 IL-20 & its receptors were epigenetically regulated through histone post-translational modifications and DNA CpG residue methylation. Also, treatment with recombinant IL-20 resulted in decreased expression of the VEGF family members at the mRNA level.
21109726 The G allele of the IL-20 -1723C to G polymorphism may contribute to a genetic susceptibility to psoriasis in the Chinese Han population, particularly in patients with psoriasis triggered or exacerbated by an upper respiratory tract infection.
20976276 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20061404 Essentially identical phenotypes in transgenic mouse models for IL-20, IL-22, and IL-24 suggest that the three related cytokines play a redundant role in keratinocyte differentiation and proliferation.
19830738 Data show that in lesional skin of psoriasis patients, highly elevated IL-20 levels strongly correlated with IL-22, and to a lesser extent, with IL-17A and TNF-alpha.
19802007 Data show that JAK1/STAT-activating ligands, interleukin 10, IL20, IL24, and IL6 were expressed by senescent cells, supporting autocrine/paracrine activation of JAK1/STAT.
19481430 in premenopausal obese women, interleukin-20 levels are higher than matched normal weight control women, are associated with body weight and waist-hip ratio, and are reduced by weight loss
19430480 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
19342680 IL-20 was responsive to hypoxia in vitro and in the ischemic stroke model and that up-regulation of IL-20 in the ischemic brain may contribute to brain injury
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19087313 Observational study of gene-disease association. (HuGE Navigator)
18771958 novel effects of IL-20 on mesangial cells and its association with lupus nephritis.
18758357 IL-20 plays an important role in the pathogenesis of disc herniation.
18479293 results suggest that IL10 and IL20 gene variants influence hepatitis B virus infection outcome
18479293 Observational study of gene-disease association. (HuGE Navigator)
18281438 Activation of toll-like receptors 2 and 3 show keratinocytes in the simultaneous presence of IL-20 and IL-29.
18061474 Both IL-20 and IL-24 showed correlations to CCL2/MCP-1 in plasma from rheumatoid arthritis and spondyloarthropathy patients.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17465720 Review. The role of IL-20 in the pathogenesis of inflammatory diseases is reviewed.
17263806 Observational study of gene-disease association. (HuGE Navigator)
17263806 extended haplotype analysis revealed an association of IL19/IL20 haplotype GACACCGGAA with a higher risk for palmoplantar pustulosis (PPP) and of IL20/IL24 haplotype CAAAC with a reduced risk for PPP
17255956 p38 mitogen-activated protein kinase (MAPK) as well as inhibitory kappaB kinase-NF-kappaB signaling pathways are crucial for IL-20 expression in keratinocytes
17083366 IL-19, IL-20 and IL-24 are distinct from classical ILs and constitute a separate subfamily of mediators within the IL-10 family
16908179 IL-20 protein is expressed in 30 non-neoplastic tissue types and five major cell types: epithelial cells, myoepithelial cells, endothelial cells, macrophages, skeletal muscle cells, and several types of tumor cells.
16778121 IL-20 is a proatherogenic cytokine that contributes to the progression of atherosclerosis.
16709143 Ultraviolet light with photosensitizing agents had little effect or decreased epithelial keratinocyte il-20 levels.
16645593 IL-20 may influence inflammation through IFN-like effects. These data indicate that IL-20 may be an important effector cytokine in psoriasis, and that its inhibition may represent a potential therapeutic target.
16511554 IL-20 is a pleiotropic cytokine and promotes angiogenesis.
15950941 Altogether our findings revealed that IL-20 is a negative modulator of COX-2/PGE(2) and inhibits angiogenesis.
15857508 IL-20 is upregulated by HIV-1 Tat treatment in human epithelial cells
15815689 Observational study of gene-disease association. (HuGE Navigator)
15815689 A study of 54 SNPs and haplotypes in the IL10 region indicate that IL10 and IL19/IL20 may be involved in natural clearance of HCV in the African Americans while no significant associations were detected in European Americans.
14675174 IL-19 and IL-20 are synthesized by a distinct population of keratinocytes.
14580208 forms stable complex with interleukin-20 receptor
12855566 human IL-20 enhanced colony formation by CD34+ multipotential progenitors, buthad no effect on erythroid, granulocyte-macrophage, or megakaryocyte progenitors.
12351624 examination of ligand/receptor interactions and in signal transduction that may lead to specificity and distinct biology

AA Sequence

MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTES      1 - 70
LQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMK     71 - 140
KYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE                                      141 - 176
//

Text Mined References (63)

PMID Year Title
26404542 2015 Altered expression of IL-10 family cytokines in monocytes from CRMO patients result in enhanced IL-1? expression and release.
26354610 2015 Type 2 diabetes - Tuberculosis co-morbidity is associated with diminished circulating levels of IL-20 subfamily of cytokines.
25631632 2015 Circulating serum levels of IL-20 in multiple myeloma patients: its significance in angiogenesis and disease activity.
25543042 2014 The correlation between IL-20 and the Th2 immune response in human asthma.
25178435 2015 Distribution of interleukin-10 family cytokines in serum and synovial fluid of patients with inflammatory arthritis reveals different contribution to systemic and joint inflammation.
25028099 2014 Interleukin-20 promotes airway remodeling in asthma.
24628979 2014 Interleukin 20 protein locates to distinct mononuclear cells in psoriatic skin.
24470401 2014 Decreased interleukin-20 expression in scleroderma skin contributes to cutaneous fibrosis.
23892591 2014 Potential synergy between SNP and CpG-A or IL-1? in regulating transcriptional activity of IL-20 promoter.
23812620 2013 Decreased interleukin-20 level in patients with systemic sclerosis: are they related with angiogenesis?
23271730 2013 Interleukin-20 promotes migration of bladder cancer cells through extracellular signal-regulated kinase (ERK)-mediated MMP-9 protein expression leading to nuclear factor (NF-?B) activation by inducing the up-regulation of p21(WAF1) protein expression.
23207823 2013 IL-10-- and IL-20--expressing epithelial and inflammatory cells are increased in patients with ulcerative colitis.
23183096 2013 Genetic polymorphisms of interleukin 20 (IL-20) in patients with ulcerative colitis.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23000500 2013 IL-19 and IL-20 genes polymorphisms and haplotype analysis in a vesicoureteral reflux population.
22962576 2012 Identification of pro-inflammatory cytokines associated with muscle invasive bladder cancer; the roles of IL-5, IL-20, and IL-28A.
22948742 2013 Combination of IL-1 receptor antagonist, IL-20 and CD40 ligand for the prediction of acute cellular renal allograft rejection.
22930279 2013 IL-20, IL-21 and p40: potential biomarkers of treatment response for ustekinumab.
22802649 2012 Structural basis for receptor sharing and activation by interleukin-20 receptor-2 (IL-20R2) binding cytokines.
22232181 2012 Purification, crystallization and preliminary X-ray diffraction analysis of the IL-20-IL-20R1-IL-20R2 complex.
21565488 2011 IL-20 is epigenetically regulated in NSCLC and down regulates the expression of VEGF.
21109726 2011 The association between the IL-20-1723C?G allele on the 1q chromosome and psoriasis triggered or exacerbated by an upper respiratory tract infection in the Chinese Han population.
20976276 2010 Interleukin-10 (IL-10) pathway: genetic variants and outcomes of HIV-1 infection in African American adolescents.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20061404 2010 IL-24 transgenic mice: in vivo evidence of overlapping functions for IL-20, IL-22, and IL-24 in the epidermis.
19830738 2009 The Th17 cytokine IL-22 induces IL-20 production in keratinocytes: a novel immunological cascade with potential relevance in psoriasis.
19802007 2010 Cytokine expression and signaling in drug-induced cellular senescence.
19481430 2010 Interleukin-20 circulating levels in obese women: effect of weight loss.
19430480 2009 Genome-wide association study and meta-analysis find that over 40 loci affect risk of type 1 diabetes.
19342680 2009 IL-20 is regulated by hypoxia-inducible factor and up-regulated after experimental ischemic stroke.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19087313 2008 Polymorphisms in the interleukin-10 gene cluster are possibly involved in the increased risk for major depressive disorder.
18771958 2008 Interleukin-20 targets renal mesangial cells and is associated with lupus nephritis.
18758357 2008 IL-20 may contribute to the pathogenesis of human intervertebral disc herniation.
18479293 2008 Evaluation of IL10, IL19 and IL20 gene polymorphisms and chronic hepatitis B infection outcome.
18281438 2008 Maturing dendritic cells are an important source of IL-29 and IL-20 that may cooperatively increase the innate immunity of keratinocytes.
18061474 2008 The expression of IL-20 and IL-24 and their shared receptors are increased in rheumatoid arthritis and spondyloarthropathy.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17465720 2007 IL-19 and IL-20: two novel cytokines with importance in inflammatory diseases.
17263806 2007 Association analysis of IL19, IL20 and IL24 genes in palmoplantar pustulosis.
17255956 2007 IL-20 gene expression is induced by IL-1beta through mitogen-activated protein kinase and NF-kappaB-dependent mechanisms.
17083366 2006 Interleukin (IL)-19, IL-20 and IL-24 are produced by and act on keratinocytes and are distinct from classical ILs.
16908179 2006 Tissue microarray analysis of interleukin-20 expression.
16778121 2006 IL-20 is expressed in atherosclerosis plaques and promotes atherosclerosis in apolipoprotein E-deficient mice.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16709143 Ultraviolet B light stimulates interleukin-20 expression by human epithelial keratinocytes.
16645593 2006 Prominent production of IL-20 by CD68+/CD11c+ myeloid-derived cells in psoriasis: Gene regulation and cellular effects.
16511554 2006 Interleukin-20 promotes angiogenesis in a direct and indirect manner.
15950941 2005 IL-20, an anti-angiogenic cytokine that inhibits COX-2 expression.
15815689 2005 Single nucleotide polymorphisms and haplotypes in the IL10 region associated with HCV clearance.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14675174 2003 Epidermal overexpression of interleukin-19 and -20 mRNA in psoriatic skin disappears after short-term treatment with cyclosporine a or calcipotriol.
14580208 2003 Characterization of the recombinant extracellular domains of human interleukin-20 receptors and their complexes with interleukin-19 and interleukin-20.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12855566 2003 Selective enhancement of multipotential hematopoietic progenitors in vitro and in vivo by IL-20.
12667095 2003 IL-20: a new target for the treatment of inflammatory skin disease.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12351624 2002 Interleukins 19, 20, and 24 signal through two distinct receptor complexes. Differences in receptor-ligand interactions mediate unique biological functions.
12023331 2002 Cutting edge: immune cells as sources and targets of the IL-10 family members?
11470428 2001 Cytokines: IL-20 - a new effector in skin inflammation.
11163236 2001 Interleukin 20: discovery, receptor identification, and role in epidermal function.