Property Summary

Ligand Count 16
NCBI Gene PubMed Count 687
PubMed Score 24027.62
PubTator Score 16378.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 5.282 2.6
Disease Target Count Z-score Confidence
Cancer 2499 7.323 3.7

Expression

 HCA RNA Cell Line (1)

PDB (23)

Gene RIF (720)

AA Sequence

MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKA      1 - 70
TELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNR     71 - 140
WITFCQSIISTLT                                                             141 - 153
//

Text Mined References (687)

PMID Year Title