Property Summary

NCBI Gene PubMed Count 27
PubMed Score 27.86
PubTator Score 11.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 1563 1.1e-04
Disease Target Count Z-score Confidence
psoriasis 6685 4.213 2.1
Dermatitis 141 3.176 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.400 1.2e-03
tuberculosis -1.300 1.1e-04

Gene RIF (12)

PMID Text
26269592 The ubiquitin-binding Tollip protein contributed to IL-36R signaling and increased the accumulation of both subunits of the IL-36R.
25902739 IL36A-IL36R axis is modulated in patients with primary Sjogren's syndrome.
22315422 These data provide evidence that IL-38 binds to the IL-36R, as does IL-36Ra.[IL-38, IL-36R]
22144259 Expression of IL-1Rrp2 by sone dendritic cell subsets may have an important function in the human immune response in vivo via its role in differentiation of inflammatory Th1 lymphocytes.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20353565 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19684156 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19180518 Observational study of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
16546408 IL-1alpha and IL-1beta gene polymorphisms do not act as a strong susceptibility factor for MTLE-HS in individuals of Turkish ancestry

AA Sequence

MWSLLLCGLSIALPLSVTADGCKDIFMKNEILSASQPFAFNCTFPPITSGEVSVTWYKNSSKIPVSKIIQ      1 - 70
SRIHQDETWILFLPMEWGDSGVYQCVIKGRDSCHRIHVNLTVFEKHWCDTSIGGLPNLSDEYKQILHLGK     71 - 140
DDSLTCHLHFPKSCVLGPIKWYKDCNEIKGERFTVLETRLLVSNVSAEDRGNYACQAILTHSGKQYEVLN    141 - 210
GITVSITERAGYGGSVPKIIYPKNHSIEVQLGTTLIVDCNVTDTKDNTNLRCWRVNNTLVDDYYDESKRI    211 - 280
REGVETHVSFREHNLYTVNITFLEVKMEDYGLPFMCHAGVSTAYIILQLPAPDFRAYLIGGLIALVAVAV    281 - 350
SVVYIYNIFKIDIVLWYRSAFHSTETIVDGKLYDAYVLYPKPHKESQRHAVDALVLNILPEVLERQCGYK    351 - 420
LFIFGRDEFPGQAVANVIDENVKLCRRLIVIVVPESLGFGLLKNLSEEQIAVYSALIQDGMKVILIELEK    421 - 490
IEDYTVMPESIQYIKQKHGAIRWHGDFTEQSQCMKTKFWKTVRYHMPPRRCRPFPPVQLLQHTPCYRTAG    491 - 560
PELGSRRKKCTLTTG                                                           561 - 575
//

Text Mined References (31)

PMID Year Title
26269592 2015 Signal Transduction and Intracellular Trafficking by the Interleukin 36 Receptor.
25902739 2015 Interleukin-36? axis is modulated in patients with primary Sjögren's syndrome.
24829417 2014 IL-36 promotes myeloid cell infiltration, activation, and inflammatory activity in skin.
23999434 2013 Common genetic variation at the IL1RL1 locus regulates IL-33/ST2 signaling.
23966867 2013 Genome-wide association of body fat distribution in African ancestry populations suggests new loci.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22315422 2012 IL-38 binds to the IL-36 receptor and has biological effects on immune cells similar to IL-36 receptor antagonist.
22144259 2012 Expression of IL-1Rrp2 by human myelomonocytic cells is unique to DCs and facilitates DC maturation by IL-1F8 and IL-1F9.
21860022 2011 IL-36R ligands are potent regulators of dendritic and T cells.
20959797 2010 IL-1 family nomenclature.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20353565 2010 Allelic variants of IL1R1 gene associate with severe hand osteoarthritis.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19684156 2009 Association between interleukin 1 gene cluster polymorphisms and bilateral distal interphalangeal osteoarthritis.
19180518 2009 Associations of 25 structural, degradative, and inflammatory candidate genes with lumbar disc desiccation, bulging, and height narrowing.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
16646978 2006 The new IL-1 family member IL-1F8 stimulates production of inflammatory mediators by synovial fibroblasts and articular chondrocytes.
16546408 2006 Lack of association between IL-1beta/alpha gene polymorphisms and temporal lobe epilepsy with hippocampal sclerosis.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11466363 2001 Two novel IL-1 family members, IL-1 delta and IL-1 epsilon, function as an antagonist and agonist of NF-kappa B activation through the orphan IL-1 receptor-related protein 2.
10882729 2000 Identification and characterization of two members of a novel class of the interleukin-1 receptor (IL-1R) family. Delineation of a new class of IL-1R-related proteins based on signaling.
10191101 1999 Interleukin-1 receptor cluster: gene organization of IL1R2, IL1R1, IL1RL2 (IL-1Rrp2), IL1RL1 (T1/ST2), and IL18R1 (IL-1Rrp) on human chromosome 2q.
9325300 1997 Purification and characterization of the human interleukin-18 receptor.
8898719 1996 Cloning of a cDNA encoding a novel interleukin-1 receptor related protein (IL 1R-rp2).
8332913 1993 Interleukin-1 type II receptor: a decoy target for IL-1 that is regulated by IL-4.
1833184 1991 A novel IL-1 receptor, cloned from B cells by mammalian expression, is expressed in many cell types.