Property Summary

NCBI Gene PubMed Count 31
PubMed Score 38.73
PubTator Score 11.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
tuberculosis 2010 1.1e-04
psoriasis 6694 1.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Dermatitis 157 3.593 1.8
Hidradenitis suppurativa 13 3.227 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.400 1.2e-03
tuberculosis -1.300 1.1e-04

Gene RIF (16)

AA Sequence

MWSLLLCGLSIALPLSVTADGCKDIFMKNEILSASQPFAFNCTFPPITSGEVSVTWYKNSSKIPVSKIIQ      1 - 70
SRIHQDETWILFLPMEWGDSGVYQCVIKGRDSCHRIHVNLTVFEKHWCDTSIGGLPNLSDEYKQILHLGK     71 - 140
DDSLTCHLHFPKSCVLGPIKWYKDCNEIKGERFTVLETRLLVSNVSAEDRGNYACQAILTHSGKQYEVLN    141 - 210
GITVSITERAGYGGSVPKIIYPKNHSIEVQLGTTLIVDCNVTDTKDNTNLRCWRVNNTLVDDYYDESKRI    211 - 280
REGVETHVSFREHNLYTVNITFLEVKMEDYGLPFMCHAGVSTAYIILQLPAPDFRAYLIGGLIALVAVAV    281 - 350
SVVYIYNIFKIDIVLWYRSAFHSTETIVDGKLYDAYVLYPKPHKESQRHAVDALVLNILPEVLERQCGYK    351 - 420
LFIFGRDEFPGQAVANVIDENVKLCRRLIVIVVPESLGFGLLKNLSEEQIAVYSALIQDGMKVILIELEK    421 - 490
IEDYTVMPESIQYIKQKHGAIRWHGDFTEQSQCMKTKFWKTVRYHMPPRRCRPFPPVQLLQHTPCYRTAG    491 - 560
PELGSRRKKCTLTTG                                                           561 - 575
//

Text Mined References (35)

PMID Year Title