Property Summary

NCBI Gene PubMed Count 205
PubMed Score 107.05
PubTator Score 1427.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adrenocortical adenoma -1.854 1.8e-02
adrenocortical carcinoma -2.649 6.0e-07
cystic fibrosis 2.300 1.4e-02
intraductal papillary-mucinous neoplasm ... -1.600 6.5e-03
lung adenocarcinoma -2.100 1.0e-09
lung cancer -3.600 1.4e-05
lung carcinoma -2.800 1.2e-12
malignant mesothelioma -2.100 9.7e-06
medulloblastoma, large-cell 1.100 1.4e-04
non primary Sjogren syndrome sicca -1.100 1.8e-02
non-small cell lung cancer -2.387 4.4e-11
ovarian cancer 1.100 2.4e-12
pancreatic ductal adenocarcinoma liver m... -2.228 2.1e-04
pituitary cancer -1.800 7.2e-03
psoriasis 1.400 3.5e-04
uncontrolled asthma 1.400 1.2e-04

Gene RIF (168)

AA Sequence

MGFWILAILTILMYSTAAKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQ      1 - 70
LLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYN     71 - 140
WTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSL    141 - 210
FPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGL    211 - 280
ACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPIDHHSIYCIIAVCSVFLMLINVLVIIL    281 - 350
KMFWIEATLLWRDIAKPYKTRNDGKLYDAYVVYPRNYKSSTDGASRVEHFVHQILPDVLENKCGYTLCIY    351 - 420
GRDMLPGEDVVTAVETNIRKSRRHIFILTPQITHNKEFAYEQEVALHCALIQNDAKVILIEMEALSELDM    421 - 490
LQAEALQDSLQHLMKVQGTIKWREDHIANKRSLNSKFWKHVRYQMPVPSKIPRKASSLTPLAAQKQ        491 - 556
//

Text Mined References (208)

PMID Year Title