Property Summary

NCBI Gene PubMed Count 35
PubMed Score 63.93
PubTator Score 44.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 2.7
Disease Target Count
Mental retardation 21, X-linked 1

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.400 8.8e-07
astrocytic glioma -1.100 7.7e-03
atypical teratoid / rhabdoid tumor -2.000 7.3e-05
ependymoma -1.600 3.6e-02
glioblastoma -1.900 2.0e-06
group 3 medulloblastoma -2.600 1.4e-06
malignant mesothelioma -3.700 5.8e-08
medulloblastoma, large-cell -2.400 4.1e-04
ovarian cancer -1.900 9.7e-09
primitive neuroectodermal tumor -1.900 1.4e-03
psoriasis -1.200 4.5e-10

Gene RIF (22)

AA Sequence

MKAPIPHLILLYATFTQSLKVVTKRGSADGCTDWSIDIKKYQVLVGEPVRIKCALFYGYIRTNYSLAQSA      1 - 70
GLSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVIRNSTYCMKVSISLTVGENDT     71 - 140
GLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKTWRPSIVFKRDTLLIREVREDD    141 - 210
IGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMESKLTIQETQLGDSANLTCRAFFGYSGDVSPL    211 - 280
IYWMKGEKFIEDLDENRVWESDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLH    281 - 350
KRELMYTVELAGGLGAILLLLVCLVTIYKCYKIEIMLFYRNHFGAEELDGDNKDYDAYLSYTKVDPDQWN    351 - 420
QETGEEERFALEILPDMLEKHYGYKLFIPDRDLIPTGTYIEDVARCVDQSKRLIIVMTPNYVVRRGWSIF    421 - 490
ELETRLRNMLVTGEIKVILIECSELRGIMNYQEVEALKHTIKLLTVIKWHGPKCNKLNSKFWKRLQYEMP    491 - 560
FKRIEPITHEQALDVSEQGPFGELQTVSAISMAAATSTALATAHPDLRSTFHNTYHSQMRQKHYYRSYEY    561 - 630
DVPPTGTLPLTSIGNQHTYCNIPMTLINGQRPQTKSSREQNPDEAHTNSAILPLLPRETSISSVIW        631 - 696
//

Text Mined References (36)

PMID Year Title