Property Summary

NCBI Gene PubMed Count 260
PubMed Score 362.92
PubTator Score 385.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Ankylosing spondylitis 138 0.0 1.0
ulcerative colitis 2087 0.0 2.0

Expression

  Differential Expression (30)

Disease log2 FC p
malignant mesothelioma -5.700 1.4e-09
oligodendroglioma -1.100 1.5e-02
psoriasis -1.800 8.1e-05
cystic fibrosis 1.889 9.5e-06
medulloblastoma, large-cell -1.800 4.2e-04
Duchenne muscular dystrophy 1.018 3.0e-07
juvenile dermatomyositis 1.067 7.9e-12
acute quadriplegic myopathy 1.242 2.4e-05
adrenocortical carcinoma -1.408 3.0e-03
tuberculosis -4.200 3.4e-06
primary pancreatic ductal adenocarcinoma 1.409 5.2e-03
intraductal papillary-mucinous adenoma (... -1.900 2.7e-03
intraductal papillary-mucinous carcinoma... -2.300 1.1e-02
intraductal papillary-mucinous neoplasm ... -1.700 4.5e-02
lung cancer -3.200 1.2e-06
interstitial cystitis 1.200 8.2e-05
group 3 medulloblastoma -1.700 4.8e-03
pilocytic astrocytoma 1.100 1.5e-02
posterior fossa group A ependymoma 1.500 7.2e-05
aldosterone-producing adenoma -1.258 1.2e-02
subependymal giant cell astrocytoma 4.208 4.3e-03
Breast cancer -1.200 6.6e-03
lung carcinoma -1.700 8.1e-13
mucosa-associated lymphoid tissue lympho... 2.186 6.4e-03
ulcerative colitis 2.500 1.9e-06
ovarian cancer -3.000 2.7e-08
Gaucher disease type 1 -2.100 1.7e-02
pituitary cancer -2.800 3.1e-06
pancreatic cancer 1.300 1.0e-02
dermatomyositis 1.100 1.6e-02

 CSPA Cell Line (4)

Gene RIF (231)

PMID Text
26975823 IL1R1 SNP rs949963 is associated with the susceptibility to asthma in children from Central China and may increase the serum expression of IL1R1.
26560040 Altered expression of EP2 in patients with aspirin-exacerbated respiratory disease contributes to deficient induction of IL-1RI, reducing the capacity of IL-1beta to increase COX-2 and mPGES-1 expression, which results in low PGE2 production
26279140 The results present identification of critical regions within the TIR domain of IL-1 receptor type in humans and mice.
26098632 investigated the association between four inflammatory cytokines (CD121a, interleukin [IL]-1beta, IL-8, and IL-11) and coronary heart disease
26076982 IL-1R1 expression appears to define a tissue regulatory T cell phenotype together with the expression of CD25, glucocorticoid-induced tumor necrosis factor receptor family-related gene and CTLA-4.
25749018 This study found that the mRNA expression of IL-1R1, TNFR1, and TNFR2 was significantly higher in schizophreina
25697140 TNF-alpha (-308) GG, IL-10 (-819) TT, IL-10 (-1082) GG and IL1R (+1970) CC genotypes are found to be predominant (p=0.01, p=0.02, p=0.0001 and p=0.001, respectively) in both tuberculoid as well as lepromatous leprosy patients.
25453823 Blood monocytes from renal cell carcinoma patients displayed a tumor-promoting transcriptional profile that supported functions like angiogenesis and invasion. Induction of this protumor phenotype required an interleukin-1 receptor (IL-1R)-dependent mechanism.
25425640 SUMOylation is a novel mechanism in the regulation of beta-arrestin 2-mediated IL-1R/TRAF6 signaling
25240697 severe forms of pancreatitis are associated with increased levels of IL-6, IL-10 and IL-1ra
25108563 FcgammaRIIa cross-talk with TLRs, IL-1R, and IFNgammaR selectively modulates cytokine production in human myeloid cells.
25014791 Single nucleotide polymorphisms in RBPJ, IL1R1, REV3L, TRAF3IP2, IRF1 and ICOS showed association with rheumatoid arthritis in black South Africans.
24988285 the NLRP3 inflammasome/IL-1RI axis is dispensable for PM10-facilitated allergic sensitization.
24976267 IL-1 receptor gene polymorphisms could be one of the factors influencing the expression of membrane-bound IL-1 receptors on immunocompetent cells.
24842757 results demonstrate clear functional consequences of the rs917997 risk polymorphism; this polymorphism leads to a loss-of-function through decreased IL-18RAP, IL-18R1, and IL-1R1 protein expression, which impairs autocrine IL-18 and IL-1 signaling
24818754 Thirty-eight single nucleotide polymorphisms (SNPs) were identified within genomic regions containing all exons and relevant exon-intron boundaries in IL1R1 and IL1R2 in japanese aggressive periodontitis.
24458711 IL1R1- and IL1beta-related transcripts are elevated in the setting of obesity; IL1R1/IL1beta augment both megakaryocyte and platelet functions, promoting a prothrombotic environment during infection and obesity; potentially contributing to the development of atherothrombotic disease
24356554 No significant differences are detected in the Fcgamma-RIIa and IL1-Ra polymorphisms compared to controls in a study to search for associations between antineutrophil cytoplasm antibody-associated vasculitis and IL1R1 polymorphisms.
24328419 Only the IL1RN tandem repeats polymorphism may be associated with Hashimoto's thyroiditis susceptibility; TSHR and IL1RN polymorphisms may represent prognostic factors for predicting the severity of the disease.
24315345 ). Findings provide evidence of subgroups of women with breast cancer who report distinct trajectories of attentional function and of a genetic association between subgroup membership and an IL1R1 promoter polymorphism.
24080160 These results provide evidence for a key role of Rac1 in a pathway that regulates IL-1-induced gene expression depending on receptor endocytosis.
23722873 The frequency of the IL-1RN rs315952 CT genotype was significantly lower among patients with systemic lupus erythematosus compared with healthy controls
23634226 Common IL-33 and IL1RL1 polymorphisms contribute to the risk of inflammatory bowel disease
23407395 These results demonstrate that IL-1alpha and IL-1R1 signaling is essential for microabscess formation, neutrophil recruiting chemokine expression, and acanthosis in psoriasis-like skin inflammation induced by imiquimod.
23375040 T allele of the 511 site of IL-1beta gene and V allele of the second introne of IL-1Ra gene are associated with the infertility occurrence of polycystic ovary syndrome patients
23253688 genetic polymorphism is associated with atopic dermatitis in Iranian pediatric population
23022958 The internalization of IL1RI after IL-1 binding is not a mechanism of feedback inhibition but of critical importance for the IL-1-induced gene expression.
22594576 The IL1R1 promoter SNP rs2192752 may contribute to the location of papillary thyroid carcinoma (PTC), and the C allele of rs2192752 may be a risk factor for the development of PTC in both lobes.
22574108 a genetic link between rs1921622 IL1RL1 polymorphism and disease severity in RSV bronchiolitis
22515947 This study demonistrated that Carriers of the minor allele for a single nucleotide polymorphism in interleukin (IL)1-receptor 1 (IL1R1) (rs2110726) were less likely to report breast pain prior to surgery
22509941 The IL-1R1 1498T>C polymorphism is associated with early-stage endometriosis in Korean women.
22435759 Analysis of the data suggested that IL-1R1 expression in the neonatal period provides an additional level of Myd88-dependent signaling during this period of heighted susceptibility to infection.
22426547 The study presents the crystal structure of IL-1beta bound to its primary receptor IL-1RI and its receptor accessory protein IL-1RAcP.
22417897 No sufficient evidence was available to support any associations between IL1-Ra and IL6-147G/C polymorphisms and ischemic stroke.
22385245 findings demonstrate that neutrophils express IL-1R1 and that IL-1R1 is induced following extravasation and exists in a mobile intracellular compartment
22285486 data demonstrated that IL-1R polymorphism is associated with susceptibility to ankylosing spondylitis
22267087 the LCAP related changes in sIL-1RI and IL-1Ra might impact the clinical outcome during treatment with an LCAP filter in patients with inflammatory bowel disease
22262840 a role for TILRR in selective amplification of NF-kappaB responses through IL-1RI and suggest that the specificity is determined by changes in receptor conformation and adapter protein recruitment.
22173128 Data suggest that c-kit is an important regulator of IL-1 receptor 1/IL-1beta signaling and effector functions in mast cells; such signaling is IL-relevant for IL-6 release.
22031183 regulates S100A8/A9-dependent keratinocyte resistance to bacterial invasion
21998454 IL-1RI expression in regulatory T (Treg)cells identifies a subpopulation at an early stage of differentiation.
21858107 Data sshow that variants in SFTPD, CD46 and IL1R1 are associated with IPD in both EA and AA.
21787753 This study found for the first time an epigallocatechin gallate-induced downregulation of the IL-1RI expression possibly being caused by NF-kappaB inhibition.
21435443 Interleukin-1 receptor-mediated inflammation impairs the heat shock response of human mesothelial cells
21281963 IL1RL1 polymorphisms are associated with serum IL1RL1-a, blood eosinophils, and asthma in childhood
21086908 Observational study of gene-disease association. (HuGE Navigator)
21083841 IL-1RI expression was not altered in endometrioid carcinoma cells in comparison with endometrial cells, clear-cells, serous and mucinous ovarian cancer cells.
20959405 Observational study of gene-disease association. (HuGE Navigator)
20956022 No association was found between recurrent spontaneous abortion and gene polymorphisms in the interleukin-1 receptor 1 gene.
20956022 Observational study of gene-disease association. (HuGE Navigator)
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20818961 Observational study of gene-disease association. (HuGE Navigator)
20816195 Observational study of gene-disease association. (HuGE Navigator)
20811626 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20806065 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20799037 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20709104 Observational study of gene-disease association. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20603050 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20568250 Observational study of gene-disease association. (HuGE Navigator)
20523065 Serum levels of ECP, IL-5, -6, -8 and -10, G-CSF, MCP-1, IL-1 ra and IP-10 were significantly elevated in acute compared with stable childhhood asthma.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20400062 Observational study of gene-disease association. (HuGE Navigator)
20353565 An association between severe hand osteoarthritis and IL1R1 gene.
20353565 Observational study of gene-disease association. (HuGE Navigator)
20349753 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20213229 Observational study of gene-disease association. (HuGE Navigator)
20140262 Observational study of gene-disease association. (HuGE Navigator)
20120526 No significant association of IL1R1 with retinopathy or nephropathy in Croatian patients with type I diabetes
20120526 Observational study of gene-disease association. (HuGE Navigator)
20066156 findings that human Tregs preferentially express receptors for TNF and IL-1 suggest a potential function in sensing and dampening local inflammation
19965648 Human Th17 cell differentiation is regulated via differential expression of IL-1RI, which is controlled by IL-7 and IL-15.
19950169 Data demonstrate that PKC-alpha is induced by several MyD88-dependent TLR/IL-1R ligands and regulates cytokine expression in human and murine DC.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19940113 Data suggest that TILRR is an IL-1RI co-receptor, which associates with the signaling receptor complex to enhance recruitment of MyD88 and control Ras-dependent amplification of NF-kappaB and inflammatory responses.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19860911 Observational study of gene-disease association. (HuGE Navigator)
19844779 Observational study of gene-disease association. (HuGE Navigator)
19822442 Data suggest that in the Brazilian population, the polymorphism of the IL-1ra gene is a relevant factor for rheumatic heart disease severity.
19819943 Data show that activation of TLR2 in purified human beta-cells and islets stimulated the expression of proinflammatory factors, and IL-1RI activity increased the TLR2 response in human islets.
19801678 Data show that Nox2 and IL-1R1 localize to plasma membrane lipid rafts in the unstimulated state and that IL-1beta signals caveolin-1-dependent endocytosis of both proteins into the redoxosome.
19773451 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19738620 Observational study of gene-disease association. (HuGE Navigator)
19729601 Observational study of gene-disease association. (HuGE Navigator)
19716405 DSCR1-1S isoform positively modulates IL-1R-mediated signaling pathways by regulating Tollip/IRAK-1/TRAF6 complex formation.
19702713 This the first study to show a positive correlation between polymorphisms in the IL-1alpha and IL-1RA genes and susceptibility to Graves' ophthalmopathy.
19702713 Observational study of gene-disease association. (HuGE Navigator)
19684156 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19683555 Observational study of gene-disease association. (HuGE Navigator)
19594368 Observational study of genotype prevalence. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19488045 This study indicated that statistically significant higher protein and mRNA levels of the il1r in frontal corte in bipolar disorder.
19470040 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19431193 Observational study of gene-disease association. (HuGE Navigator)
19428986 IL-1ra was expressed within the length of the human fallopian tube only in menstrual cycle secretory phase and in the intraauterine pregnancies samples
19408823 Observational study of genotype prevalence. (HuGE Navigator)
19339270 Observational study of gene-disease association. (HuGE Navigator)
19332120 Observational study of gene-disease association. (HuGE Navigator)
19290009 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19232518 These results indicate that TRAF6-mediated ubiquitination of IL-1R1 has a decisive role in IL-1R1 signalling and propose a molecular mechanism whereby TRAF6 promotes ubiquitination and RIP of IL-1R1 through its ubiquitin ligase activity.
19211154 Long-term, but not short-term memory is impaired in a transgenic mouse strain overexpressing human soluble interleukin-1 receptor antagonist (IL-1ra) in the brain.
19180518 Observational study of gene-disease association. (HuGE Navigator)
19142372 Observational study of gene-disease association. (HuGE Navigator)
19141860 Observational study of gene-disease association. (HuGE Navigator)
19117745 Observational study of gene-disease association. (HuGE Navigator)
19076825 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
18996842 TRAF6 and interleukin receptor-associated kinase 2 are novel binding partners for PS1, and IL-1R1 is a new substrate for presenilin-dependent gamma-secretase cleavage
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18810365 IL-6 and IL-1Ra polymorphisms can be considered genetic markers for bronchial asthma susceptibility and/or severity among Egyptian children.
18773331 Observational study of gene-disease association. (HuGE Navigator)
18763028 Observational study of gene-disease association. (HuGE Navigator)
18632425 Observational study of genotype prevalence. (HuGE Navigator)
18624935 Mild or intensive immunoreactivity for IL-1RI was observed in the epithelial cells in all cases, and in the endothelial cells and fibroblasts in five cases of keratocystic odontogenic tumors.
18576303 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18484169 polymorphism is not associated with the presence of pulmonary aspergillosis infection; but in combination with IL1a and IL1b genotypes may predict disease susceptibility
18322311 Observational study of gene-disease association. (HuGE Navigator)
18321953 The expression of the IL-1 receptor, a known regulator of SREBP-2, was also elevated after exercise.
18052726 results showed that there was a gender difference in IL-1Ra gene polymorphism expressed by a higher incidence of IL1RN*1/IL1RN*1 homozygotes and a lower occurrence of IL1RN*1/IL1RN*2 heterozygotes in men compared with women
17889143 Observational study of gene-disease association. (HuGE Navigator)
17703412 Observational study of gene-disease association. (HuGE Navigator)
17688691 This study shows an increase in gene and protein production for the IL-1 receptor type I in degenerate intervertebral discs.
17627763 Observational study of genotype prevalence. (HuGE Navigator)
17622942 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17607501 rheumatic heart disease cases showed a significantly higher frequency of homozygous genotypes of IL-1Ra A1/A1. Cases with mitral valve disease showed higher frequencies of genotype IL-1Ra(VNTR) A1/A1.
17584583 Observational study of gene-disease association. (HuGE Navigator)
17517439 Abnormal interleukin 1 receptor types I and II gene expression in eutopic and ectopic endometrial tissues of women with endometriosis.
17480058 Conformational stability of rhIL1ra was monitored by equilibrium urea denaturation, and thermodynamic parameters of unfolding; conformational stability, monitored using the Cm value, has an effect on oxidation rates of buried methionines
17477815 Observational study of gene-disease association. (HuGE Navigator)
17413037 Observational study of gene-disease association. (HuGE Navigator)
17324958 Our study showed an imbalance in the expression of IL1R1 and IL1R2 in eutopic, and particularly in ectopic, endometrial tissues of women with endometriosis
17257312 Observational study of genotype prevalence. (HuGE Navigator)
17083033 Observational study of gene-disease association. (HuGE Navigator)
16938461 Observational study of gene-disease association. (HuGE Navigator)
16937503 Observational study of gene-disease association. (HuGE Navigator)
16911713 Observational study of gene-disease association. (HuGE Navigator)
16911713 Distributions of single-base polymorphisms of the human IL-1RI gene were evaluated and a C-->A transition in exon 1C showed protective effect against endometriosis in heterozygotes.
16573560 Observational study of gene-disease association. (HuGE Navigator)
16564702 icIL-1ra1 does not act at an intracellular level to alter IL-1 mediated signalling, and is effective in inhibiting IL-1 responses only when released in an ATP-dependent and cell type specific manner
16354686 Rac1 facilitated the recruitment of Nox2 into the endosomal compartment and subsequent redox-dependent recruitment of TRAF6 to the MyD88/IL-1R1 complex.
16323614 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16305343 data describe percentage of bone marrow cells expressing receptors for interleukin-1, platelet-derived growth factor, fibroblast growth factor, transforming growth factor-beta, epidermal growth factor and c-Fos and c-Myc in untreated lung & breast cancer
16301860 Meta-analysis and HuGE review of gene-disease association, gene-gene interaction, and healthcare-related. (HuGE Navigator)
16258158 Observational study of gene-disease association. (HuGE Navigator)
16258158 Our findings indicate that the VDR FokI polymorphism and several VDR and IL-1-R1 haplotypes are associated with susceptibility to T1DM in the Dalmatian population.
16100774 Observational study of genotype prevalence. (HuGE Navigator)
15919456 Observational study of gene-disease association. (HuGE Navigator)
15866876 SIGIRR inhibits IL-1R and TLR4-mediated signaling through different mechanisms
15797878 Observational study of gene-disease association. (HuGE Navigator)
15789892 Observational study of gene-disease association. (HuGE Navigator)
15723707 Observational study of gene-disease association. (HuGE Navigator)
15653174 Observational study of gene-disease association. (HuGE Navigator)
15481335 Observational study of gene-disease association. (HuGE Navigator)
15472211 the dysregulation of IL-1/IL-1-R system relates to immunological dysfunction in endometriosis
15388348 Data show that Exip, but not p38alpha, binds to Toll interacting protein, which is involved in interleukin-1 (IL-1) signaling pathway, and impaired NF-kappaB activity.
15375600 Observational study of gene-disease association. (HuGE Navigator)
15361128 Observational study of genotype prevalence. (HuGE Navigator)
15300624 Sixteen SNPs were identified through a 9643 bp sequencing of IL-1R1 gene. Four were in 5' flank region, four in intron region, one in coding region, and seven in 3' untranslated region.
15190266 Observational study of gene-disease association. (HuGE Navigator)
15188516 There is an association between polymorphisms of the promoter region -511C/T of IL-1B and IL-1RN intron 2 and chronic hepatitis B virus infection
15170937 Observational study of gene-disease association. (HuGE Navigator)
14872281 Observational study of gene-disease association. (HuGE Navigator)
14872281 IL-1RA gene polymorphism is not responsible for specific clinical characteristics in RA and SLE but that IL-1RN*2 is relevant in the susceptibility to RA.
14758530 high allele frequency of the IL1RN*2 allele may affect disease susceptibility in childhood nephrotic syndrome
14735144 Observational study of gene-disease association. (HuGE Navigator)
14734209 Observational study of gene-disease association. (HuGE Navigator)
14680589 Observational study of gene-disease association. (HuGE Navigator)
14644395 Observational study of gene-disease association. (HuGE Navigator)
14563376 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14557872 Observational study of gene-disease association. (HuGE Navigator)
12890860 Observational study of gene-disease association. (HuGE Navigator)
12804791 A decrease in interleukin-1 receptor antagonist expression in the prefrontal cortex of schizophrenic patients.
12752101 Observational study of gene-disease association. (HuGE Navigator)
12729621 IL-1 receptor has a role in the pathway linking static compression to reduced proteoglycan synthesis
12595908 Observational study of gene-disease association. (HuGE Navigator)
12558814 Observational study of genotype prevalence. (HuGE Navigator)
12477576 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12472674 Observational study of gene-disease association. (HuGE Navigator)
12425801 Observational study of gene-disease association. (HuGE Navigator)
12424621 Observational study of gene-disease association. (HuGE Navigator)
12412204 Observational study of gene-disease association. (HuGE Navigator)
12363051 Observational study of gene-disease association. (HuGE Navigator)
12240899 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12212456 Observational study of gene-disease association. (HuGE Navigator)
12164325 Observational study of genotype prevalence. (HuGE Navigator)
12145738 Observational study of gene-disease association. (HuGE Navigator)
12138282 Observational study of gene-disease association. (HuGE Navigator)
12136897 Carriage of ILRN*2 alleles influences disease severity rather than susceptibility.
12133437 Observational study of gene-disease association. (HuGE Navigator)
12095061 Observational study of gene-disease association. (HuGE Navigator)
12082592 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12038885 Observational study of gene-disease association. (HuGE Navigator)
12028539 Observational study of gene-disease association. (HuGE Navigator)
11956022 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11851889 Observational study of gene-disease association. (HuGE Navigator)
11849463 Observational study of gene-disease association. (HuGE Navigator)
11849463 Carriage of IL1beta and IL1RN*2, together with non-carriage of TNF2 is associated with increased susceptibility, but not with a prognosis of IgAN.
11846196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11838837 Observational study of gene-disease association. (HuGE Navigator)
11820460 Heparins (unfractionated heparin, UFH and low molecular weight heparin certoparin) had no effect on the release of IL-1ra, IL-10, and IL-12p40 from neutrophils or peripheral blood mononuclear cells.
11790645 Observational study of gene-disease association. (HuGE Navigator)
11762793 Observational study of gene-disease association. (HuGE Navigator)
11752505 Observational study of gene-disease association. (HuGE Navigator)
11742191 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
11665666 Observational study of gene-disease association. (HuGE Navigator)
11578018 Observational study of gene-disease association. (HuGE Navigator)
11527622 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11508575 Observational study of gene-disease association. (HuGE Navigator)
11506478 Observational study of gene-disease association. (HuGE Navigator)
11427627 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11390630 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11380940 Observational study of genotype prevalence. (HuGE Navigator)
11380474 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11233912 Observational study of gene-disease association. (HuGE Navigator)
11220627 Observational study of gene-disease association. (HuGE Navigator)
11197691 Observational study of gene-disease association. (HuGE Navigator)
11127457 Observational study of gene-disease association. (HuGE Navigator)
11083263 Observational study of gene-disease association. (HuGE Navigator)
11040178 Observational study of gene-disease association. (HuGE Navigator)
7818827 HIV-1 Tat upregulates the expression of IL-1RA in uninfected mononuclear cells

AA Sequence

MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQ      1 - 70
ASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGL     71 - 140
VCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPIT    141 - 210
RVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYS    211 - 280
VENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQKHMIGICVTLTVIIV    281 - 350
CSVFIYKIFKIDIVLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCG    351 - 420
YKLFIYGRDDYVGEDIVEVINENVKKSRRLIIILVRETSGFSWLGGSSEEQIAMYNALVQDGIKVVLLEL    421 - 490
EKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYHMPVQRRSPSSKHQLLSPATKEKL    491 - 560
QREAHVPLG                                                                 561 - 569
//

Text Mined References (265)

PMID Year Title
26975823 2016 [Association between IL1R1 gene polymorphisms and childhood asthma].
26560040 2016 Low E-prostanoid 2 receptor levels and deficient induction of the IL-1?/IL-1 type I receptor/COX-2 pathway: Vicious circle in patients with aspirin-exacerbated respiratory disease.
26279140 2015 Identification of critical regions within the TIR domain of IL-1 receptor type I.
26098632 2015 Serum CD121a (Interleukin 1 Receptor, Type I): A Potential Novel Inflammatory Marker for Coronary Heart Disease.
26076982 2015 IL-1R1 is expressed on both Helios(+) and Helios(-) FoxP3(+) CD4(+) T cells in the rheumatic joint.
25749018 2015 Proinflammatory cytokines and their membrane-bound receptors are altered in the lymphocytes of schizophrenia patients.
25697140 2015 Association of TNF-?-(308(GG)), IL-10(-819(TT)), IL-10(-1082(GG)) and IL-1R1(+1970(CC)) genotypes with the susceptibility and progression of leprosy in North Indian population.
25453823 2014 Molecular profiling reveals a tumor-promoting phenotype of monocytes and macrophages in human cancer progression.
25425640 2015 SUMOylation attenuates human ?-arrestin 2 inhibition of IL-1R/TRAF6 signaling.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
25240697 High plasma levels of the pro-inflammatory cytokine IL-22 and the anti-inflammatory cytokines IL-10 and IL-1ra in acute pancreatitis.
25108563 2015 Fc?RIIa cross-talk with TLRs, IL-1R, and IFN?R selectively modulates cytokine production in human myeloid cells.
25014791 2014 Immunochip identifies novel, and replicates known, genetic risk loci for rheumatoid arthritis in black South Africans.
24988285 2015 The nucleotide-binding domain, leucine-rich repeat protein 3 inflammasome/IL-1 receptor I axis mediates innate, but not adaptive, immune responses after exposure to particulate matter under 10 ?m.
24976267 2015 Relationship between interleukin-1 type 1 and 2 receptor gene polymorphisms and the expression level of membrane-bound receptors.
24842757 2014 The IL18RAP region disease polymorphism decreases IL-18RAP/IL-18R1/IL-1R1 expression and signaling through innate receptor-initiated pathways.
24818754 2014 Interleukin-1 receptor gene variants are associated with aggressive periodontitis in the Japanese.
24458711 2014 Interleukin 1 receptor 1 and interleukin 1? regulate megakaryocyte maturation, platelet activation, and transcript profile during inflammation in mice and humans.
24356554 2013 A candidate gene approach to ANCA-associated vasculitis reveals links to the C3 and CTLA-4 genes but not to the IL1-Ra and Fc?-RIIa genes.
24328419 2014 Polymorphisms in TSHR and IL1RN genes and the risk and prognosis of Hashimoto's thyroiditis.
24315345 2014 Association between an interleukin 1 receptor, type I promoter polymorphism and self-reported attentional function in women with breast cancer.
24080160 2014 Interleukin-1-induced activation of the small GTPase Rac1 depends on receptor internalization and regulates gene expression.
23999434 2013 Common genetic variation at the IL1RL1 locus regulates IL-33/ST2 signaling.
23969696 2013 Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease.
23722873 2013 Interleukin-1 gene cluster and IL-1 receptor polymorphisms in Iranian patients with systemic lupus erythematosus.
23634226 2013 Associations between genetic polymorphisms in IL-33, IL1R1 and risk for inflammatory bowel disease.
23407395 2013 IL-1R1 signaling facilitates Munro's microabscess formation in psoriasiform imiquimod-induced skin inflammation.
23375040 2013 Correlation between IL-1?, IL-1Ra gene polymorphism and occurrence of polycystic ovary syndrome infertility.
23253688 Association of single nucleotide polymorphisms of interleukin-1 family with atopic dermatitis.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23022958 2013 Regulation of NF-?B-dependent gene expression by ligand-induced endocytosis of the interleukin-1 receptor.
22594576 2012 Association between a promoter polymorphism (rs2192752, -1028A/C) of interleukin 1 receptor, type I (IL1R1) and location of papillary thyroid carcinoma in a Korean population.
22574108 2012 IL1RL1 gene variants and nasopharyngeal IL1RL-a levels are associated with severe RSV bronchiolitis: a multicenter cohort study.
22561531 2012 Genome-wide association study to identify genetic determinants of severe asthma.
22515947 2012 Associations between pro- and anti-inflammatory cytokine genes and breast pain in women prior to breast cancer surgery.
22509941 2012 The association between endometriosis and polymorphisms in the interleukin-1 family genes in Korean women.
22435759 2012 A novel role for interleukin-1 receptor signaling in the developmental regulation of immune responses to endotoxin.
22426547 2012 Structure of the activating IL-1 receptor signaling complex.
22417897 2012 Polymorphisms of interleukin-1 and interleukin-6 genes on the risk of ischemic stroke in a meta-analysis.
22385245 2012 In-vivo extravasation induces the expression of interleukin 1 receptor type 1 in human neutrophils.
22285486 2011 Association of IL1R polymorphism with HLA-B27 positive in Iranian patients with ankylosing spondylitis.
22267087 2012 Kinetics of the soluble IL-1 receptor type I during treatment with an LCAP filter in patients with inflammatory bowel disease.
22262840 2012 Distinct control of MyD88 adapter-dependent and Akt kinase-regulated responses by the interleukin (IL)-1RI co-receptor, TILRR.
22173128 2012 C-Kit controls IL-1?-induced effector functions in HMC-cells.
22031183 2012 IL-1 receptor regulates S100A8/A9-dependent keratinocyte resistance to bacterial invasion.
21998454 2011 Ex vivo IL-1 receptor type I expression in human CD4+ T cells identifies an early intermediate in the differentiation of Th17 from FOXP3+ naive regulatory T cells.
21858107 2011 Identifying host genetic risk factors in the context of public health surveillance for invasive pneumococcal disease.
21787753 2011 EGCG downregulates IL-1RI expression and suppresses IL-1-induced tumorigenic factors in human pancreatic adenocarcinoma cells.
21435443 2011 Interleukin-1 receptor-mediated inflammation impairs the heat shock response of human mesothelial cells.
21281963 2011 Interleukin-1 receptor-like 1 polymorphisms are associated with serum IL1RL1-a, eosinophils, and asthma in childhood.
21086908 2010 Cytokine gene polymorphisms in sarcoidosis.
21083841 2011 Endometrioid ovarian cancer and endometriotic cells exhibit the same alteration in the expression of interleukin-1 receptor II: to a link between endometriosis and endometrioid ovarian cancer.
20959405 2010 The IFNG (IFN-gamma) genotype predicts cytogenetic and molecular response to imatinib therapy in chronic myeloid leukemia.
20956022 2011 Polymorphisms in VEGF, progesterone receptor and IL-1 receptor genes in women with recurrent spontaneous abortion.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20818961 2011 Inflammatory mediators gene polymorphisms in preeclampsia.
20816195 2010 Analyses of shared genetic factors between asthma and obesity in children.
20811626 2010 Genetic variants in inflammation-related genes are associated with radiation-induced toxicity following treatment for non-small cell lung cancer.
20806065 2010 Host genetic factors and vaccine-induced immunity to HBV infection: haplotype analysis.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20799037 2011 Gene-gene interaction between tuberculosis candidate genes in a South African population.
20709104 2010 Interleukin 1 receptor antagonist polymorphisms are associated with the risk of developing acute coronary syndrome in Mexicans.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20603050 2010 A 3-factor epistatic model predicts digital ulcers in Italian scleroderma patients.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20523065 2010 Serum eosinophil cationic protein and 27 cytokines/chemokines in acute exacerbation of childhood asthma.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20400062 2010 The interleukin-1 family gene polymorphisms and Graves' disease.
20353565 2010 Allelic variants of IL1R1 gene associate with severe hand osteoarthritis.
20349753 2009 Association of 22 cytokine gene polymorphisms with tuberculosis in Macedonians.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20213229 2010 Cytokine polymorphisms and Alzheimer disease: possible associations.
20140262 2010 Maternal and fetal genetic associations of PTGER3 and PON1 with preterm birth.
20120526 2009 Retinopathy and nephropathy in type 1 diabetic patients--association with polymorphysms of vitamin D-receptor, TNF, Neuro-D and IL-1 receptor 1 genes.
20066156 2010 Expression and function of TNF and IL-1 receptors on human regulatory T cells.
19965648 2010 Regulating human Th17 cells via differential expression of IL-1 receptor.
19950169 2010 PKC-alpha controls MYD88-dependent TLR/IL-1R signaling and cytokine production in mouse and human dendritic cells.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19940113 2010 TILRR, a novel IL-1RI co-receptor, potentiates MyD88 recruitment to control Ras-dependent amplification of NF-kappaB.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19860911 2009 Variation in cytokine genes can contribute to severity of acetabular osteolysis and risk for revision in patients with ABG 1 total hip arthroplasty: a genetic association study.
19844779 2010 Proinflammatory cytokine gene polymorphisms in irritable bowel syndrome.
19822442 2010 Interleukin-1 receptor antagonist gene (IL1RN) polymorphism possibly associated to severity of rheumatic carditis in a Brazilian cohort.
19819943 2009 Free fatty acids induce a proinflammatory response in islets via the abundantly expressed interleukin-1 receptor I.
19801678 2009 Lipid rafts and caveolin-1 coordinate interleukin-1beta (IL-1beta)-dependent activation of NFkappaB by controlling endocytosis of Nox2 and IL-1beta receptor 1 from the plasma membrane.
19773451 2009 Role of inflammation gene polymorphisms on pain severity in lung cancer patients.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19738620 2009 Tumour necrosis factor gene polymorphism: a predictive factor for the development of post-transplant lymphoproliferative disease.
19729601 2009 Candidate gene polymorphisms for ischemic stroke.
19716405 2009 Down syndrome candidate region-1 protein interacts with Tollip and positively modulates interleukin-1 receptor-mediated signaling.
19702713 2009 Graves' ophthalmopathy and gene polymorphisms in interleukin-1alpha, interleukin-1beta, interleukin-1 receptor and interleukin-1 receptor antagonist.
19684156 2009 Association between interleukin 1 gene cluster polymorphisms and bilateral distal interphalangeal osteoarthritis.
19683555 2009 Role of human leukocyte antigen, killer-cell immunoglobulin-like receptors, and cytokine gene polymorphisms in leptospirosis.
19594368 2009 Distribution of cytokine gene polymorphisms in the general Lebanese population: the first report.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19488045 2010 Increased excitotoxicity and neuroinflammatory markers in postmortem frontal cortex from bipolar disorder patients.
19470040 2010 TNF-alpha and IL-10 gene polymorphisms show a weak association with pemphigus vulgaris in the Slovak population.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19431193 2009 IL1B polymorphisms modulate cystic fibrosis lung disease.
19428986 2009 Interleukin-1 system in the human fallopian tube-No spatial but a temporal regulation of mRNA and protein expression.
19408823 2009 Distribution of the 22 cytokine gene polymorphisms in healthy Macedonian population.
19339270 2009 Genetic associations of 115 polymorphisms with cancers of the upper aerodigestive tract across 10 European countries: the ARCAGE project.
19332120 2009 Effect of desensitization in solid organ transplant recipients depends on some cytokines genes polymorphism.
19290009 2009 Variants of the interleukin-1 receptor antagonist gene are associated with fat mass in men.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19232518 2009 TRAF6 promotes ubiquitination and regulated intramembrane proteolysis of IL-1R1.
19211154 2009 Impaired long term memory consolidation in transgenic mice overexpressing the human soluble form of IL-1ra in the brain.
19180518 2009 Associations of 25 structural, degradative, and inflammatory candidate genes with lumbar disc desiccation, bulging, and height narrowing.
19142372 2008 Interleukin-1 receptor antagonist gene VNTR polymorphism is associated with coronary artery disease.
19141860 2009 Genetic variants in the candidate genes of the apoptosis pathway and susceptibility to chronic myeloid leukemia.
19117745 2009 Cytokine gene polymorphisms and BALF cytokine levels in interstitial lung diseases.
19076825 2009 Proinflammatory cytokine gene single nucleotide polymorphisms in common variable immunodeficiency.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18996842 2009 Interleukin-1 receptor type 1 is a substrate for gamma-secretase-dependent regulated intramembrane proteolysis.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18810365 2008 Gene polymorphisms of IL-6(-174) G/C and IL-1Ra VNTR in asthmatic children.
18773331 2008 Correlation between genetic polymorphism of cytokine genes, plasma protein levels and bronchial asthma in the Han people in northern China.
18763028 2009 Proinflammatory cytokine gene polymorphisms among Iranian patients with asthma.
18632425 2008 Cytokine single nucleotide polymorphisms in Iranian populations.
18624935 2008 Immunohistochemical analysis of interleukin-1 alpha, its type I receptor and antagonist in keratocystic odontogenic tumors.
18576303 2008 Ability of epistatic interactions of cytokine single-nucleotide polymorphisms to predict susceptibility to disease subsets in systemic sclerosis patients.
18484169 2008 IL1 gene cluster polymorphisms and its haplotypes may predict the risk to develop invasive pulmonary aspergillosis and modulate C-reactive protein level.
18322311 2008 IL-1, IL-1R and TNFalpha gene polymorphisms in Iranian patients with multiple sclerosis.
18321953 2008 Gene expression profiling in human skeletal muscle during recovery from eccentric exercise.
18052726 2007 The existence of gender difference in IL-1Ra gene polymorphism.
17889143 2007 Cytokine polymorphisms and risk of infection after kidney transplantation.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17688691 2007 Catabolic cytokine expression in degenerate and herniated human intervertebral discs: IL-1beta and TNFalpha expression profile.
17627763 2007 Single nucleotide polymorphisms of cytokine genes in the healthy Slovak population.
17622942 2007 Pharmacogenetics of glatiramer acetate therapy for multiple sclerosis reveals drug-response markers.
17607501 Gene polymorphisms of TNF-alpha(-308), IL-10(-1082), IL-6(-174), and IL-1Ra(VNTR) related to susceptibility and severity of rheumatic heart disease.
17584583 2007 Interleukin-1 gene complex polymorphisms in systemic sclerosis patients with severe restrictive lung physiology.
17517439 2008 Abnormal interleukin 1 receptor types I and II gene expression in eutopic and ectopic endometrial tissues of women with endometriosis.
17480058 2007 Oxidation of methionine residues in recombinant human interleukin-1 receptor antagonist: implications of conformational stability on protein oxidation kinetics.
17477815 2007 Polymorphisms in proinflammatory genes and susceptibility to typhoid fever and paratyphoid fever.
17413037 2007 Haplotypes of IL1B, IL1RN, IL1R1, and IL1R2 and the risk of venous thrombosis.
17324958 2007 Imbalance in the expression of the activating type I and the inhibitory type II interleukin 1 receptors in endometriosis.
17257312 2007 Frequency distribution of cytokine gene polymorphisms in the healthy North Indian population.
17083033 2006 Exhaustive genotyping of the interleukin-1 family genes and associations with AIDS progression in a French cohort.
16938461 2006 Cytokine gene polymorphisms can alter the effect of Bacillus Calmette-Guérin (BCG) immunotherapy.
16937503 2006 Polymorphisms of interleukin-1R receptor antagonist genes in patients with chronic hepatitis B in Iran.
16911713 2006 Polymorphisms in exons 1B and 1C of the type I interleukin-1 receptor gene in patients with endometriosis.
16573560 2006 Th1/Th2 cytokine gene polymorphisms in patients with idiopathic pulmonary fibrosis.
16564702 2006 Action of intracellular IL-1Ra (Type 1) is independent of the IL-1 intracellular signalling pathway.
16477012 2006 Synergistic roles of platelet-derived growth factor-BB and interleukin-1beta in phenotypic modulation of human aortic smooth muscle cells.
16354686 2006 Nox2 and Rac1 regulate H2O2-dependent recruitment of TRAF6 to endosomal interleukin-1 receptor complexes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16323614 The IL-6 G-174C polymorphism may be associated with ischaemic stroke in patients without a history of hypertension.
16305343 2005 Alteration on the expression of IL-1, PDGF, TGF-beta, EGF, and FGF receptors and c-Fos and c-Myc proteins in bone marrow mesenchymal stroma cells from advanced untreated lung and breast cancer patients.
16301860 Genetic variation associated with preterm birth: a HuGE review.
16286467 2006 Interleukin-1beta induction of NFkappaB is partially regulated by H2O2-mediated activation of NFkappaB-inducing kinase.
16258158 2005 FokI polymorphism, vitamin D receptor, and interleukin-1 receptor haplotypes are associated with type 1 diabetes in the Dalmatian population.
16100774 2005 Cytokine gene polymorphisms in population of ethnic Macedonians.
15919456 2005 Cytokine polymorphisms do not influence acute rejection in renal transplantation under tacrolimus-based immunosuppression.
15866876 2005 SIGIRR inhibits interleukin-1 receptor- and toll-like receptor 4-mediated signaling through different mechanisms.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15797878 Interleukin-1 gene cluster polymorphisms and alcoholism in Spanish men.
15789892 Interleukin-1 receptor antagonist gene polymorphism in Taiwanese patients with gout.
15723707 2005 Polymorphisms in immunoregulatory genes and the risk of histologic chorioamnionitis in Caucasoid women: a case control study.
15653174 2005 Genotypes and haplotypes in the IL-1 gene cluster: analysis of two genetically and diagnostically distinct groups of Alzheimer patients.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15481335 2004 A functional polymorphism in the interleukin-1 receptor-1 gene is associated with increased risk of Helicobacter pylori infection but not with gastric cancer.
15472211 2004 Down-regulation of interleukin-1 receptor type 1 expression causes the dysregulated expression of CXC chemokines in endometriotic stromal cells: a possible mechanism for the altered immunological functions in endometriosis.
15388348 2004 Exip, a splicing variant of p38alpha, participates in interleukin-1 receptor proximal complex and downregulates NF-kappaB pathway.
15375600 2004 Effects of genetic and nutritional factors on bone mineral density in young adults.
15361128 2004 Cytokine gene polymorphisms in Taiwan.
15300624 2004 [An investigation of polymorphism in IL-1R1 gene in Chinese population and the functional prediction of a variation in the transmembrane region of IL-1R1].
15190266 2004 Extended haplotypes and linkage disequilibrium in the IL1R1-IL1A-IL1B-IL1RN gene cluster: association with knee osteoarthritis.
15188516 2004 Polymorphisms of interleukin-1B and interleukin-1 receptor antagonist genes in patients with chronic hepatitis B.
15170937 2004 Association of single nucleotide polymorphisms within cytokine genes with juvenile idiopathic arthritis in the Czech population.
15028279 2004 PCR isolation and cloning of novel splice variant mRNAs from known drug target genes.
14872281 2004 Interleukin-1 receptor antagonist gene polymorphism and rheumatoid arthritis.
14758530 2004 Association of IL-1beta, IL-1ra, and TNF-alpha gene polymorphisms in childhood nephrotic syndrome.
14735144 2004 Functional correlates of the interleukin-1 receptor antagonist gene polymorphism in the colonic mucosa in ulcerative colitis.
14734209 2004 Polymorphism of interleukin-1 receptor antagonist gene and obesity.
14680589 2003 [The association between interleukin-1 receptor antagonist genotype and chronic periodontitis of Uighur patients].
14644395 2003 IL-1 cluster genes and occurrence of post-percutaneous transluminal coronary angioplasty restenosis: a prospective, angiography-based evaluation.
14563376 Association between IL-1beta -511C/T and IL-1RA (86bp)n repeats polymorphisms and schizophrenia.
14557872 2003 Evidence for substantial effect modification by gender in a large-scale genetic association study of the metabolic syndrome among coronary heart disease patients.
12925853 2003 SIGIRR, a negative regulator of Toll-like receptor-interleukin 1 receptor signaling.
12890860 2004 Interleukin 1alpha, interleukin 1beta and interleukin 1 receptor gene polymorphisms in psoriatic arthritis.
12804791 2003 A decrease in interleukin-1 receptor antagonist expression in the prefrontal cortex of schizophrenic patients.
12752101 2003 Interleukin-1 genotype and outcome of unrelated donor bone marrow transplantation.
12729621 2003 A role for the interleukin-1 receptor in the pathway linking static mechanical compression to decreased proteoglycan synthesis in surface articular cartilage.
12721283 2003 TIRP, a novel Toll/interleukin-1 receptor (TIR) domain-containing adapter protein involved in TIR signaling.
12659850 2003 Characterization of a cascade of protein interactions initiated at the IL-1 receptor.
12595908 2003 Variation in immune response genes and chronic Q fever. Concepts: preliminary test with post-Q fever fatigue syndrome.
12558814 2003 Genotyping for cytokine polymorphisms: allele frequencies in the Italian population.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12477576 2002 Nonassociation of interleukin-1 receptor antagonist genotypes with bone mineral density, bone turnover status, and estrogen responsiveness in Korean postmenopausal women.
12472674 2002 Polymorphisms in interleukin-1beta and interleukin-1 receptor antagonist genes and malaria in Ghanaian children.
12425801 2002 [Genomic polymorphism within interleukin-1 family cytokines influences the outcome of septic patients].
12424621 2002 Interleukin-1 receptor antagonist VNTR-polymorphism in inflammatory bowel disease.
12412204 CC chemokine receptor 5 and interleukin-1 receptor antagonist gene polymorphisms in patients with primary Sjögren's syndrome.
12363051 2002 Susceptibility to dengue hemorrhagic fever in vietnam: evidence of an association with variation in the vitamin d receptor and Fc gamma receptor IIa genes.
12240899 2002 Bone mineral mass is associated with interleukin 1 receptor autoantigen and TNF-alpha gene polymorphisms in post-menopausal Mediterranean women.
12212456 2002 [Risk factors in adult periodontitis: polymorphism in the interleukin-1 gene family].
12164325 2002 Genotype frequencies of 50 polymorphisms for 241 Japanese non-cancer patients.
12145738 2002 Variable number tandem repeat polymorphism of the interleukin-1 receptor antagonist gene in meningococcal disease.
12138282 2002 Association of interleukin-1 receptor antagonist gene polymorphism with IgA nephropathy.
12136897 2002 Interleukin 1 receptor antagonist gene polymorphism is associated with severe renal involvement and renal sequelae in Henoch-Schönlein purpura.
12133437 2002 [Interleukin (IL)-1beta, IL-1 receptor antagonist and IL-4 gene polymorphisms in ulcerative colitis in the Chinese].
12095061 2002 Interleukin 1 and chronic rejection: possible genetic links in human heart allografts.
12082592 2002 Multi-locus interactions predict risk for post-PTCA restenosis: an approach to the genetic analysis of common complex disease.
12077269 2002 The epistatic interrelationships of IL-1, IL-1 receptor antagonist, and the type I IL-1 receptor.
12038885 2002 Polymorphisms for interleukin 1 beta exon 5 and interleukin 1 receptor antagonist in Taiwanese children with febrile convulsions.
12028539 2002 Relationship of polymorphisms of the Interleukin-1 gene cluster to occurrence and severity of rheumatoid arthritis.
11956022 The combination of the interleukin-1alpha (IL-1alpha-889) genotype and the interleukin-10 (IL-10 ATA) haplotype is associated with increased interleukin-10 (IL-10) plasma levels in healthy individuals.
11851889 2002 Promoter polymorphisms of the genes encoding tumor necrosis factor-alpha and interleukin-1beta are associated with different subtypes of psoriasis characterized by early and late disease onset.
11849463 2002 Polymorphism of the cytokine genes and IgA nephropathy.
11846196 2002 Smoking and polymorphisms of the interleukin-1 gene cluster (IL-1alpha, IL-1beta, and IL-1RN) in patients with periodontal disease.
11838837 2002 Susceptibility for and clinical manifestations of rheumatoid arthritis are associated with polymorphisms of the TNF-alpha, IL-1beta, and IL-1Ra genes.
11820460 2001 Influence of low molecular weight heparin (certoparin) and unfractionated heparin on the release of cytokines from human leukocytes.
11790645 2002 Interleukin-1 gene cluster polymorphisms in sarcoidosis and idiopathic pulmonary fibrosis.
11762793 2001 Interleukin-1beta gene and receptor antagonist gene polymorphisms in patients with calcium oxalate stones.
11752505 2001 A polymorphism within the interleukin 1 receptor antagonist (IL-1Ra) gene is associated with ankylosing spondylitis.
11742191 2001 Association of HLA-DR genotypes and IL-1ra gene polymorphism with treatment failure of budesonide and disease patterns in Crohn's disease.
11665666 2001 Polymorphisms for interleukin-1 beta (IL-1 beta)-511 promoter, IL-1 beta exon 5, and IL-1 receptor antagonist: nonassociation with endometriosis.
11641511 2001 Association of IL-1beta and IL-1 receptor antagonist haplotypes with rate of decline in lung function in smokers.
11578018 2001 Interleukin-1beta and interleukin-1 receptor antagonist gene polymorphisms in rheumatoid arthritis.
11527622 2001 Effects of interleukin-1 gene polymorphisms on the development of coronary artery disease associated with Chlamydia pneumoniae infection.
11508575 2001 Linkage and association analysis of candidate genes in rheumatoid arthritis.
11506478 2001 Allele 2 of interleukin-1 receptor antagonist gene increases the risk of thyroid peroxidase antibodies in subacute thyroiditis.
11427627 2001 Polymorphism of the cytokine genes in hospitalized patients with Puumala hantavirus infection.
11390630 2001 Interleukin-1 receptor antagonist gene polymorphism and circulating levels of human immunodeficiency virus type 1 RNA in Brazilian women.
11380940 2001 Single nucleotide polymorphisms in intron 2 of the human interleukin-1 receptor antagonist (IL-1Ra) gene: further definition of the IL-1 beta and IL-1Ra polymorphisms in North American Caucasians and Taiwanese Chinese.
11380474 2001 Donor interleukin 1 receptor antagonist genotype associated with acute graft-versus-host disease in human leucocyte antigen-matched sibling allogeneic transplants.
11278614 2001 Cloning and characterization of IL-1HY2, a novel interleukin-1 family member.
11233912 2001 Donor cytokine genotype influences the development of acute rejection after renal transplantation.
11220627 2001 Ethnic differences in allelic associations of the interleukin-1 gene cluster in South African patients with inflammatory bowel disease (IBD) and in control individuals.
11197691 2000 Characterization of new polymorphisms in the 5' UTR of the human interleukin-1 receptor type 1 (IL1R1) gene: linkage to type 1 diabetes and correlation to IL-1RI plasma level.
11127457 2000 Protective role against restenosis from an interleukin-1 receptor antagonist gene polymorphism in patients treated with coronary stenting.
11083263 2000 Association of genotypes affecting the expression of interleukin-1beta or interleukin-1 receptor antagonist with osteoarthritis.
11040178 2000 Genetic factors determine extent of bone loss in inflammatory bowel disease.
10903327 2000 X-ray crystal structure of a small antagonist peptide bound to interleukin-1 receptor type 1.
10854325 2000 Tollip, a new component of the IL-1RI pathway, links IRAK to the IL-1 receptor.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10671496 2000 Identification of two major sites in the type I interleukin-1 receptor cytoplasmic region responsible for coupling to pro-inflammatory signaling pathways.
10383454 1999 IRAK-M is a novel member of the Pelle/interleukin-1 receptor-associated kinase (IRAK) family.
10373529 1999 Activation of phosphatidylinositol 3-kinase in response to interleukin-1 leads to phosphorylation and activation of the NF-kappaB p65/RelA subunit.
10191101 1999 Interleukin-1 receptor cluster: gene organization of IL1R2, IL1R1, IL1RL2 (IL-1Rrp2), IL1RL1 (T1/ST2), and IL18R1 (IL-1Rrp) on human chromosome 2q.
9821957 1998 Phosphatidylinositol 3-kinase is recruited to a specific site in the activated IL-1 receptor I.
9374458 1997 IRAK (Pelle) family member IRAK-2 and MyD88 as proximal mediators of IL-1 signaling.
9371760 1997 Recruitment of IRAK to the interleukin 1 receptor complex requires interleukin 1 receptor accessory protein.
9360994 1997 Phosphatidylinositol 3-kinase in interleukin 1 signaling. Physical interaction with the interleukin 1 receptor and requirement in NFkappaB and AP-1 activation.
9120302 1997 Receptor induction regulates the synergistic effects of substance P with IL-1 and platelet-derived growth factor on the proliferation of bone marrow fibroblasts.
9062194 1997 A new cytokine-receptor binding mode revealed by the crystal structure of the IL-1 receptor with an antagonist.
9062193 1997 Crystal structure of the type-I interleukin-1 receptor complexed with interleukin-1beta.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8327496 1993 Interleukin 1 signaling occurs exclusively via the type I receptor.
8142597 1993 Specific binding of interleukin 1 (IL-1) beta and IL-1 receptor antagonist (IL-1ra) to human serum. High-affinity binding of IL-1ra to soluble IL-1 receptor type I.
7989776 1994 Elevated levels of shed type II IL-1 receptor in sepsis. Potential role for type II receptor in regulation of IL-1 responses.
7818827 1994 HIV-1 Tat induces cytokine synthesis by uninfected mononuclear cells.
2946959 1986 The cell surface receptors for interleukin-1 alpha and interleukin-1 beta are identical.
2532321 1989 Sequence of the cDNA for the human fibroblast type interleukin-1 receptor.
2530587 1989 Cloning the interleukin 1 receptor from human T cells.
2521881 1989 Identification of IL-1 receptors on human monocytes.
1833184 1991 A novel IL-1 receptor, cloned from B cells by mammalian expression, is expressed in many cell types.
1672292 1991 Chromosomal location of murine and human IL-1 receptor genes.