Property Summary

NCBI Gene PubMed Count 41
PubMed Score 16.19
PubTator Score 14.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Atopic dermatitis 944 2.6e-06
Disease Target Count Z-score Confidence
Ankylosing spondylitis 138 3.361 1.7

Gene RIF (17)

PMID Text
26819499 results indicate that circulating IL-38 is a potentially novel biomarker for patients with ST-segment elevation myocardial infarction
26314375 Data suggest that IL-38 may be protective in SLE. A strong association between IL-38 and SLE severity suggests that IL-38 expression is driven by processes linked to SLE pathogenesis.
24969107 rs6759676, closest gene locus IL1F10 is associated with increased circulating levels of IL-1 receptor antagonist, a protective factor in development of insulin resistance.
22315422 These data provide evidence that IL-38 binds to the IL-36R, as does IL-36Ra.[IL-38, IL-36R]
22312160 The IL1A locus was strongly associated with alkylosing spondyloarthritis phenotype, whereas IL1F10 was associated with non-alkylosing spondyloarthritis.
20975573 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20141484 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
18484691 Observational study of gene-disease association. (HuGE Navigator)
18361937 Observational study of gene-disease association. (HuGE Navigator)
18063673 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)
16361275 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICILPNRGLARTKVPIFLGIQGGSRCLAC      1 - 70
VETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEP     71 - 140
SARTKFYFEQSW                                                              141 - 152
//

Text Mined References (41)

PMID Year Title
26819499 2015 Elevated Plasma IL-38 Concentrations in Patients with Acute ST-Segment Elevation Myocardial Infarction and Their Dynamics after Reperfusion Treatment.
26314375 2015 Brief Report: Interleukin-38 Exerts Antiinflammatory Functions and Is Associated With Disease Activity in Systemic Lupus Erythematosus.
24969107 2014 Genetic determinants of circulating interleukin-1 receptor antagonist levels and their association with glycemic traits.
24182552 2014 Novel gene variants predict serum levels of the cytokines IL-18 and IL-1ra in older adults.
23969696 2013 Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease.
22939635 2012 Genome-wide association and population genetic analysis of C-reactive protein in African American and Hispanic American women.
22315422 2012 IL-38 binds to the IL-36 receptor and has biological effects on immune cells similar to IL-36 receptor antagonist.
22312160 2012 Association between the IL-1 family gene cluster and spondyloarthritis.
21300955 2011 Meta-analysis of genome-wide association studies in >80 000 subjects identifies multiple loci for C-reactive protein levels.
20975573 2011 Interleukin 1 ? (IL-1B) and IL-1 antagonist receptor (IL-1RN) gene polymorphisms are associated with the genetic susceptibility and steroid dependence in patients with ulcerative colitis.
20959797 2010 IL-1 family nomenclature.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20141484 2010 The interleukin-1 family gene polymorphisms in Korean patients with rheumatoid arthritis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
18484691 2008 Interleukin 1 polymorphisms in patients with ankylosing spondylitis in Korea.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
18361937 2008 The interleukin 1B-511 polymorphism is associated with the risk of developing restenosis after coronary stenting in Mexican patients.
18063673 2008 Prospective meta-analysis of interleukin 1 gene complex polymorphisms confirms associations with ankylosing spondylitis.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
16361275 2006 Replication of association of IL1 gene complex members with ankylosing spondylitis in Taiwanese Chinese.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11991723 2002 Genomic organization of the interleukin-1 locus.
11991722 2002 A sequence-based map of the nine genes of the human interleukin-1 cluster.
11747621 2001 Identification of a novel human cytokine gene in the interleukin gene cluster on chromosome 2q12-14.
11574262 2001 A new nomenclature for IL-1-family genes.
11466363 2001 Two novel IL-1 family members, IL-1 delta and IL-1 epsilon, function as an antagonist and agonist of NF-kappa B activation through the orphan IL-1 receptor-related protein 2.
11278614 2001 Cloning and characterization of IL-1HY2, a novel interleukin-1 family member.
11145836 2001 IL-1H, an interleukin 1-related protein that binds IL-18 receptor/IL-1Rrp.
11093146 2000 A tissue specific IL-1 receptor antagonist homolog from the IL-1 cluster lacks IL-1, IL-1ra, IL-18 and IL-18 antagonist activities.
10860666 2000 Identification and gene organization of three novel members of the IL-1 family on human chromosome 2.
10744718 2000 Identification and initial characterization of four novel members of the interleukin-1 family.
10625660 2000 Four new members expand the interleukin-1 superfamily.
10512743 1999 IL1HY1: A novel interleukin-1 receptor antagonist gene.
9169134 1997 Molecular cloning of the interleukin-1 gene cluster: construction of an integrated YAC/PAC contig and a partial transcriptional map in the region of chromosome 2q13.
8188271 1994 A physical map of the region encompassing the human interleukin-1 alpha, interleukin-1 beta, and interleukin-1 receptor antagonist genes.