Property Summary

Ligand Count 1
NCBI Gene PubMed Count 849
PubMed Score 3688.88
PubTator Score 6881.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
tuberculosis 2010 2.4e-11
lung carcinoma 2843 9.3e-09
ulcerative colitis 1819 3.2e-04
cystic fibrosis 1696 3.6e-04
lung cancer 4740 5.2e-03
cutaneous lupus erythematosus 1057 1.1e-02
oligodendroglioma 2850 2.7e-02
Disease Target Count Z-score Confidence
Endometriosis 540 0.0 1.2
Schizophrenia 1160 0.0 1.9
Type 2 diabetes mellitus 272 0.0 0.7

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -3.500 1.5e-08
cutaneous lupus erythematosus 1.800 1.1e-02
cystic fibrosis 1.683 3.6e-04
lung cancer -1.200 5.2e-03
lung carcinoma -1.900 9.3e-09
oligodendroglioma -1.100 2.7e-02
tuberculosis -7.300 2.4e-11
ulcerative colitis 2.500 3.2e-04

Protein-protein Interaction (2)

Gene RIF (917)

AA Sequence

MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETSKTSKLTFKES      1 - 70
MVVVATNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPRSAPFSFLSNVKYNFMRIIKYEFILNDAL     71 - 140
NQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEI    141 - 210
PKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA             211 - 271
//

Text Mined References (851)

PMID Year Title