Property Summary

NCBI Gene PubMed Count 76
PubMed Score 98.18
PubTator Score 100.60

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (66)

PMID Text
26522365 The level of IL-19 in the peripheral blood of allergic rhinitis(AR) patients increased and was related with the clinical severity of AR.
26486636 This study demonstrated that IL-19 and IL-24 are associated with the modulation of T-cell responses in filarial infections.
26404542 Data show reduced cytokines IL-10 and IL-19 expression, and enhanced IL-20 and il-1 beta expression in chronic recurrent multifocal osteomyelitis (CRMO) monocytes.
25639337 These findings indicate that IL-19 production is diminished in SpA. Taken together, impaired IL-19 control of the innate immune system might be involved in the pathogenesis of SpA.
25633979 these findings suggest that molecular features at the IL19 locus may modestly alter the establishment of HIV-1 infection.
25178435 Distribution of interleukin-10 family cytokines in serum and synovial fluid of patients with inflammatory arthritis reveals different
25046339 IL-19 as a component of the IL-23/IL-17 axis strengthens the IL-17A action and might be a biomarker for the activity of this axis in chronic inflammatory disorders
24943510 we delineate the detailed molecular pathway for IL-4 up-regulation of IL-19 in keratinocytes, which may play an important role in AD pathogenesis.
24919552 It supresses inflammation and its gene deletion causes inflammatory bowel disease.(review)
24819332 IL-19 rs2243188 SNP was associated with the susceptibility to lupus nephritis in a Chinese population; but the minor C allele of SNP rs2243188 might be a protective factor for systemic lupus erythematosus
24718601 Unstimulated and TLR-activated monocytes expressed significantly lower IL-19 mRNA in active CD patients.Exogenous IL-19 had an anti-inflammatory effect on HC but not in CD.
24527982 elevated gene expression in Mexican mestizo patients with active Crohn's disease
24361379 results suggest that the IL-19 gene might slightly contribute to the genetic risk of schizophrenia.
23710200 In breast cancer, IL-19 expression is correlated with increased mitotic figures, advanced tumor stage, higher metastasis, and poor survival. (Review)
23596173 IL-19 does not reduce TNF-alpha-stimulated NF-kappaB activation in Vascular endothelial cells but does decrease serine phosphorylation and cytoplasmic translocation of the mRNA stability factor HuR and significantly reduces stability of ICAM-1 and VCAM-1 mRNA.
23582717 IL-19 is important for cutaneous wound healing because it upregulates KGF expression.
23000500 A significant association was found between the combined genotypes of IL19GC + CC and IL20TG + GG and increased risk of vesicoureteral reflux.
22583192 IL-19 is overexpressed in the epithelium in Chronic rhinosinusitis with nasal polyps and increases epithelial cell proliferation.
22186257 IL-19 is pivotal in the pathogenesis of breast cancer.
22158875 Interleukin-19 (IL-19) induces heme oxygenase-1 (HO-1) expression and decreases reactive oxygen species in human vascular smooth muscle cells.
22021194 Methylation in IL-19 is associated with Crohn's disease.
21925224 protective role of gene polymorphisms in Mexican patients with ulcerative colitis
21814157 Genetic variation in adaptive immunity genes and particularly in IL19/IL20 genes associates with the development of recurrent wheeze after respiratory syncytial virus lower respiratory tract infection.
21767236 subset of fetuses with fetal inflammatory response syndrome had high umbilical cord plasma IL-19 concentrations
20976276 Observational study of gene-disease association. (HuGE Navigator)
20966397 IL-19 is mitogenic and chemotactic for endothelial cells and can induce their angiogenic potential.
20806065 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20699607 The minor allele of the IL19 rs2243188 single nucleotide polymorphism was significantly increased in vitiligo patients compared to controls.
20603037 Observational study of gene-disease association. (HuGE Navigator)
20568250 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19786281 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
19430480 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19087313 Observational study of gene-disease association. (HuGE Navigator)
18809337 IL-19 was positively stained in 15 healthy tissue types & 3 major cell types: epithelial cells, endothelial cells & macrophages; several types of tumor cells stained for IL-19, especially squamous cell carcinoma of skin, tongue, esophagus & lung
18669613 IL-19 expression in vascular smooth muscle cells (VSMCs) may represent a novel, protective, autocrine response of VSMCs to inflammatory stimuli.
18479293 Observational study of gene-disease association. (HuGE Navigator)
18246602 serum levels of IL-19 were higher in endotoxic shock patients than in healthy volunteers
18006695 Observational study of gene-disease association. (HuGE Navigator)
17703412 Observational study of gene-disease association. (HuGE Navigator)
17522354 Observational study of gene-disease association. (HuGE Navigator)
17522354 data suggest that IL-19 polymorphisms may be associated with age in a Japanese population
17465720 Review. The role of IL-19 in the pathogenesis of inflammatory diseases is reviewed.
17449492 IL-19 expression in uraemic patients has a role in the Th2 immune responses and may have a role in the cytokine dysregulation in uraemia
17263806 Observational study of gene-disease association. (HuGE Navigator)
17263806 study supports the hypothesis that variations of genes of the IL-19 subfamily of cytokines influence susceptibility to palmoplantar pustulosis
17083366 IL-19, IL-20 and IL-24 are distinct from classical ILs and constitute a separate subfamily of mediators within the IL-10 family
16778150 Data indicate that adenosine increases the release of IL-19 from bronchial epithelial cells via activation of adenosine A(2B) receptors, and IL-19 in turn activates human monocytes to release TNF-alpha, which upregulates A(2B) receptor expression.
16631120 We identified the sequence TGTGGT (-142 to -138) on PE1 as the binding site for the transcription factor AML1, and crucial for the promoter activity of IL-19 because substituting 1bp in the PE region (-139G-->T) abolished IL-19 promoter activity.
15857508 IL-19 is upregulated in human epithelial cells by HIV-1 Tat treatment
15827959 IL-19 induces IL-10, which in turn down-regulates IL-19.
15815689 Observational study of gene-disease association. (HuGE Navigator)
15815689 A study of 54 SNPs and haplotypes in the IL10 region indicate that IL10 and IL19/IL20 may be involved in natural clearance of HCV in the African Americans while no significant associations were detected in European Americans.
15557163 Elevated IL-19 serum levels in asthmatic patients are positively correlated with levels of IL-4 and IL-13, and suggest that IL-19 may play a role in the pathogenesis of asthma.
15120647 IL-19 upregulates IL-4 expression and the number of IL-4 expressing CD4+ve T-cells
14675174 IL-19 and IL-20 are synthesized by a distinct population of keratinocytes
14580208 forms stable complex with interleukin-20 receptor
12403790 an examination of the helical crystal structure of this protein
12370360 Analysis of the IL-19 promoter region shows a fragment of 394 base pairs that supports luciferase activity at a level 7- to 8-fold greater than that of the negative control.
12351624 examination of ligand/receptor interactions and in signal transduction that may lead to specificity and distinct biology

AA Sequence

MKLQCVSLWLLGTILILCSVDNHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIK      1 - 70
PLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVI     71 - 140
HDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA                                     141 - 177
//

Text Mined References (76)

PMID Year Title
26522365 2015 [Increased IL-19 level in peripheral blood of patients with allergic rhinitis is related with clinical severity].
26486636 2016 Modulation of CD4+ and CD8+ T-Cell Function by Interleukin 19 and Interleukin 24 During Filarial Infections.
26404542 2015 Altered expression of IL-10 family cytokines in monocytes from CRMO patients result in enhanced IL-1? expression and release.
25639337 2015 Toll-like receptor 2 and 4 induced interleukin-19 dampens immune reactions and associates inversely with spondyloarthritis disease activity.
25633979 Immunogenetic influences on acquisition of HIV-1 infection: consensus findings from two African cohorts point to an enhancer element in IL19 (1q32.2).
25178435 2015 Distribution of interleukin-10 family cytokines in serum and synovial fluid of patients with inflammatory arthritis reveals different contribution to systemic and joint inflammation.
25046339 2014 IL-19 is a component of the pathogenetic IL-23/IL-17 cascade in psoriasis.
24943510 2014 Interleukin-4 up-regulation of epidermal interleukin-19 expression in keratinocytes involves the binding of signal transducer and activator of transcription 6 (Stat6) to the imperfect Stat6 sites.
24919552 2014 [Emerging role of interleukin-19 as an inflammatory mediator in inflammatory bowel disease].
24819332 2014 Association study of interleukin-19 rs2243188 polymorphism with systemic lupus erythematosus in a Chinese population.
24718601 2014 Interleukin-19 impairment in active Crohn's disease patients.
24527982 2014 Expression of interleukin (IL)-19 and IL-24 in inflammatory bowel disease patients: a cross-sectional study.
24361379 2014 Association analysis of putative cis-acting polymorphisms of interleukin-19 gene with schizophrenia.
23710200 2013 Interleukin-19 in breast cancer.
23596173 2013 Interleukin-19 decreases leukocyte-endothelial cell interactions by reduction in endothelial cell adhesion molecule mRNA stability.
23582717 2013 Interleukin (IL)-19 promoted skin wound healing by increasing fibroblast keratinocyte growth factor expression.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23000500 2013 IL-19 and IL-20 genes polymorphisms and haplotype analysis in a vesicoureteral reflux population.
22583192 2012 Increased expression of IL-19 in the epithelium of patients with chronic rhinosinusitis and nasal polyps.
22186257 2012 Upregulated IL-19 in breast cancer promotes tumor progression and affects clinical outcome.
22158875 2012 Interleukin-19 (IL-19) induces heme oxygenase-1 (HO-1) expression and decreases reactive oxygen species in human vascular smooth muscle cells.
22021194 2012 Genome-wide methylation profiling in Crohn's disease identifies altered epigenetic regulation of key host defense mechanisms including the Th17 pathway.
21925224 2011 Protective role of interleukin-19 gene polymorphisms in patients with ulcerative colitis.
21814157 2011 IL10 family member genes IL19 and IL20 are associated with recurrent wheeze after respiratory syncytial virus bronchiolitis.
21767236 2012 Interleukin-19 in fetal systemic inflammation.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20976276 2010 Interleukin-10 (IL-10) pathway: genetic variants and outcomes of HIV-1 infection in African American adolescents.
20966397 2011 The anti-inflammatory cytokine interleukin 19 is expressed by and angiogenic for human endothelial cells.
20806065 2010 Host genetic factors and vaccine-induced immunity to HBV infection: haplotype analysis.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20699607 2010 Association analysis of genes of the IL19 cluster and their receptors in vitiligo patients.
20603037 2010 Single nucleotide polymorphisms in inflammation-related genes are associated with venous thromboembolism.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20228799 2010 Genome-wide association identifies multiple ulcerative colitis susceptibility loci.
19906316 2009 Discovery of novel human transcript variants by analysis of intronic single-block EST with polyadenylation site.
19786281 2010 Interleukin 10 family gene polymorphisms are not associated with major depressive disorder and panic disorder phenotypes.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19430480 2009 Genome-wide association study and meta-analysis find that over 40 loci affect risk of type 1 diabetes.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19087313 2008 Polymorphisms in the interleukin-10 gene cluster are possibly involved in the increased risk for major depressive disorder.
18809337 2008 The distribution of interleukin-19 in healthy and neoplastic tissue.
18669613 2008 Expression and suppressive effects of interleukin-19 on vascular smooth muscle cell pathophysiology and development of intimal hyperplasia.
18479293 2008 Evaluation of IL10, IL19 and IL20 gene polymorphisms and chronic hepatitis B infection outcome.
18246602 2008 IL-19 is involved in the pathogenesis of endotoxic shock.
18006695 2008 Scan of 977 nonsynonymous SNPs in CLL4 trial patients for the identification of genetic variants influencing prognosis.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17522354 2007 Association of interleukin-19 gene polymorphisms with age.
17465720 2007 IL-19 and IL-20: two novel cytokines with importance in inflammatory diseases.
17449492 2007 Expression of IL-19 correlates with Th2 cytokines in uraemic patients.
17263806 2007 Association analysis of IL19, IL20 and IL24 genes in palmoplantar pustulosis.
17083366 2006 Interleukin (IL)-19, IL-20 and IL-24 are produced by and act on keratinocytes and are distinct from classical ILs.
16778150 2006 A2B adenosine receptors induce IL-19 from bronchial epithelial cells, resulting in TNF-alpha increase.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16631120 2006 Promoter analysis of interleukin 19.
15827959 2005 Human IL-19 regulates immunity through auto-induction of IL-19 and production of IL-10.
15815689 2005 Single nucleotide polymorphisms and haplotypes in the IL10 region associated with HCV clearance.
15557163 2004 IL-19 induced Th2 cytokines and was up-regulated in asthma patients.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15120647 2004 Human interleukin-19 and its receptor: a potential role in the induction of Th2 responses.
14675174 2003 Epidermal overexpression of interleukin-19 and -20 mRNA in psoriatic skin disappears after short-term treatment with cyclosporine a or calcipotriol.
14580208 2003 Characterization of the recombinant extracellular domains of human interleukin-20 receptors and their complexes with interleukin-19 and interleukin-20.
12486876 2002 The family of IL-10-related cytokines and their receptors: related, but to what extent?
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12403790 2003 Crystal structure of interleukin-19 defines a new subfamily of helical cytokines.
12370360 2002 IL-19 induces production of IL-6 and TNF-alpha and results in cell apoptosis through TNF-alpha.
12351624 2002 Interleukins 19, 20, and 24 signal through two distinct receptor complexes. Differences in receptor-ligand interactions mediate unique biological functions.
12023331 2002 Cutting edge: immune cells as sources and targets of the IL-10 family members?
11929132 2002 The interleukin-10 family of cytokines.
11564763 2001 Cutting edge: STAT activation by IL-19, IL-20 and mda-7 through IL-20 receptor complexes of two types.
11196675 2000 Cloning, expression and initial characterization of interleukin-19 (IL-19), a novel homologue of human interleukin-10 (IL-10).
11163236 2001 Interleukin 20: discovery, receptor identification, and role in epidermal function.