Property Summary

NCBI Gene PubMed Count 42
PubMed Score 27.04
PubTator Score 35.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
ulcerative colitis 1.300 6.1e-03
cutaneous lupus erythematosus 2.400 2.7e-04
psoriasis 1.800 1.5e-36
osteosarcoma -4.188 2.6e-05
non-small cell lung cancer -1.588 8.3e-18
Common variable immunodeficiency -1.037 1.2e-02
intraductal papillary-mucinous carcinoma... -1.200 6.0e-03
intraductal papillary-mucinous neoplasm ... -1.200 1.8e-02
lung cancer -2.400 8.4e-03
interstitial cystitis 1.400 1.1e-02
lung adenocarcinoma -1.600 3.6e-10
lung carcinoma -2.400 4.9e-20
mucosa-associated lymphoid tissue lympho... 2.383 2.4e-02

Gene RIF (33)

PMID Text
26289103 This meta-analysis provides robust estimates that IL18RAP rs917997 and chemokine (C-C motif) receptor 3 rs6441961 are potential risk factors for celiac disease in European populations.
24842757 results demonstrate clear functional consequences of the rs917997 risk polymorphism; this polymorphism leads to a loss-of-function through decreased IL-18RAP, IL-18R1, and IL-1R1 protein expression, which impairs autocrine IL-18 and IL-1 signaling
23891168 The SNP modified IL18RAP surface protein expression by NK cells.
22685567 Data indicate that MyD88 works together with the IL-1/IL-18 receptors, can interact with two distinct sorting adaptors, TRAM and Mal, in a conserved manner.
22289858 Data suggest that IL-18RAP and IL-18R1 single-nucleotide polymorphisms identify African-American infants at risk for bronchopulmonary dysplasia.
21072187 Observational study of gene-disease association. (HuGE Navigator)
20647273 Observational study of gene-disease association. (HuGE Navigator)
20353565 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20176734 Observational study of gene-disease association. (HuGE Navigator)
19760754 Observational study of gene-disease association. (HuGE Navigator)
19714583 The mechanism of the impaired natural killer cell function in systemic-onset juvenile idiopathic arthritis involves a defect in IL-18Rbeta phosphorylation.
19693089 Observational study of gene-disease association. (HuGE Navigator)
19542083 Investigated the regions 2q12 (IL18RAP) and 3p21 (CCR3)in regards to celiac disease risk in the Spanish population.Two SNPs, rs917997 (2q12) and rs6441961 (3p21), were genotyped; Assoc'n was found w/rs6441961, a non-sign. result was obtained for rs917997.
19542083 Observational study of gene-disease association. (HuGE Navigator)
19473509 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19473509 Our analysis suggests that the variability of IL18RAP genes is unlikely to contribute to modulate the risk of cardiovascular disease
19336475 Observational study of gene-disease association. (HuGE Navigator)
19180518 Observational study of gene-disease association. (HuGE Navigator)
19103669 IL18RAP is a novel predisposing gene for coeliac disease.
19103669 Observational study of gene-disease association. (HuGE Navigator)
19073967 Observational study of gene-disease association. (HuGE Navigator)
18805825 Observational study of gene-disease association. (HuGE Navigator)
18774397 study provides suggestive evidence for associations of SNPs in the IL1RL1 gene and adjacently located family members IL18R1 and IL18RAP with asthma and atopy in 2 independent Dutch asthma populations
18774397 Observational study of gene-disease association. (HuGE Navigator)
18439550 CARD9 and IL18RAP are IBD loci important in innate immunity in the predisposition to both CD and UC.
18439550 Observational study of gene-disease association. (HuGE Navigator)
18311140 Variations in IL18RAP is associated with celiac disease
18311140 Genome-wide association study of gene-disease association. (HuGE Navigator)
18092318 Observational study of gene-disease association. (HuGE Navigator)
17897836 Truncated forms of IL-18RAP may be involved in the complex mechanism of IL-18 activity regulation.
16043644 Observational study of gene-disease association. (HuGE Navigator)
15760905 IL-18, IL-18 receptor alpha, and CD48 complex formation via glycosylphosphatidylinositol anchor glycan triggers binding to IL-18 receptor beta, and thereby induces intracellular signal transduction and IFN-gamma production.

AA Sequence

MLCLGWIFLWLVAGERIKGFNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRNRLSPKQVPEH      1 - 70
LPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVNNSGSYICRPKMIKSPYDVACC     71 - 140
VKMILEVKPQTNASCEYSASHKQDLLLGSTGSISCPSLSCQSDAQSPAVTWYKNGKLLSVERSNRIVVDE    141 - 210
VYDYHQGTYVCDYTQSDTVSSWTVRAVVQVRTIVGDTKLKPDILDPVEDTLEVELGKPLTISCKARFGFE    211 - 280
RVFNPVIKWYIKDSDLEWEVSVPEAKSIKSTLKDEIIERNIILEKVTQRDLRRKFVCFVQNSIGNTTQSV    281 - 350
QLKEKRGVVLLYILLGTIGTLVAVLAASALLYRHWIEIVLLYRTYQSKDQTLGDKKDFDAFVSYAKWSSF    351 - 420
PSEATSSLSEEHLALSLFPDVLENKYGYSLCLLERDVAPGGVYAEDIVSIIKRSRRGIFILSPNYVNGPS    421 - 490
IFELQAAVNLALDDQTLKLILIKFCYFQEPESLPHLVKKALRVLPTVTWRGLKSVPPNSRFWAKMRYHMP    491 - 560
VKNSQGFTWNQLRITSRIFQWKGLSRTETTGRSSQPKEW                                   561 - 599
//

Text Mined References (42)

PMID Year Title
26289103 2015 Systematic review and meta-analysis of the association between IL18RAP rs917997 and CCR3 rs6441961 polymorphisms with celiac disease risks.
25642632 2015 Discovery of six new susceptibility loci and analysis of pleiotropic effects in leprosy.
24842757 2014 The IL18RAP region disease polymorphism decreases IL-18RAP/IL-18R1/IL-1R1 expression and signaling through innate receptor-initiated pathways.
23999434 2013 Common genetic variation at the IL1RL1 locus regulates IL-33/ST2 signaling.
23891168 2013 The autoimmune disease-associated SNP rs917997 of IL18RAP controls IFN? production by PBMC.
23817571 2013 Meta-analysis of genome-wide association studies identifies ten loci influencing allergic sensitization.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23042114 2012 Genome-wide association study identifies eight new susceptibility loci for atopic dermatitis in the Japanese population.
22685567 2012 TRAM is involved in IL-18 signaling and functions as a sorting adaptor for MyD88.
22289858 2012 IL-18R1 and IL-18RAP SNPs may be associated with bronchopulmonary dysplasia in African-American infants.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
21072187 2010 Evidence for significant overlap between common risk variants for Crohn's disease and ankylosing spondylitis.
20647273 2010 Investigation of type 1 diabetes and coeliac disease susceptibility loci for association with juvenile idiopathic arthritis.
20353565 2010 Allelic variants of IL1R1 gene associate with severe hand osteoarthritis.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
20176734 2010 Comparative genetic analysis of inflammatory bowel disease and type 1 diabetes implicates multiple loci with opposite effects.
19760754 2010 Analysis of 39 Crohn's disease risk loci in Swedish inflammatory bowel disease patients.
19714583 2009 Defective phosphorylation of interleukin-18 receptor beta causes impaired natural killer cell function in systemic-onset juvenile idiopathic arthritis.
19693089 2010 Four novel coeliac disease regions replicated in an association study of a Swedish-Norwegian family cohort.
19542083 2009 Association of IL18RAP and CCR3 with coeliac disease in the Spanish population.
19473509 2009 Lack of association between polymorphisms of the IL18R1 and IL18RAP genes and cardiovascular risk: the MORGAM Project.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19180518 2009 Associations of 25 structural, degradative, and inflammatory candidate genes with lumbar disc desiccation, bulging, and height narrowing.
19103669 2009 Association study of the IL18RAP locus in three European populations with coeliac disease.
19073967 2008 Shared and distinct genetic variants in type 1 diabetes and celiac disease.
18805825 2009 Six new coeliac disease loci replicated in an Italian population confirm association with coeliac disease.
18774397 2008 Association of IL1RL1, IL18R1, and IL18RAP gene cluster polymorphisms with asthma and atopy.
18439550 2008 Genetic analysis of innate immunity in Crohn's disease and ulcerative colitis identifies two susceptibility loci harboring CARD9 and IL18RAP.
18311140 2008 Newly identified genetic risk variants for celiac disease related to the immune response.
18092318 2008 Comprehensive evaluation of positional candidates in the IL-18 pathway reveals suggestive associations with schizophrenia and herpes virus seropositivity.
17897836 2007 Identification of IL-18RAP mRNA truncated splice variants in human testis and the other human tissues.
16043644 2005 Genetic analysis of the interleukin-18 system highlights the role of the interleukin-18 gene in cardiovascular disease.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15760905 2005 Functional role played by the glycosylphosphatidylinositol anchor glycan of CD48 in interleukin-18-induced interferon-gamma production.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11788557 2002 Interleukin 18 and associated markers of T helper cell type 1 activity in coeliac disease.
11046021 2000 IL-18 receptors, their role in ligand binding and function: anti-IL-1RAcPL antibody, a potent antagonist of IL-18.
10951141 2000 Human keratinocytes constitutively produce but do not process interleukin-18.
10925275 2000 IFN-alpha and IL-12 induce IL-18 receptor gene expression in human NK and T cells.
9792649 1998 Cloning of a novel receptor subunit, AcPL, required for interleukin-18 signaling.