Property Summary

NCBI Gene PubMed Count 80
PubMed Score 27.99
PubTator Score 174.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -4.200 6.3e-08
osteosarcoma -2.978 1.4e-05
non-small cell lung carcinoma -1.500 1.9e-22
lung cancer -3.600 5.2e-05
active Crohn's disease 1.057 3.7e-03
interstitial cystitis 1.500 9.7e-05
lung adenocarcinoma -1.600 4.0e-13
lung carcinoma -2.500 3.2e-16
ulcerative colitis 1.200 5.5e-04
pituitary cancer -1.100 2.2e-03

Protein-protein Interaction (1)

Gene RIF (65)

PMID Text
26600055 IL-18 and IL-18R polymorphisms may contribute to the development and lymph node metastasis of PTC.
26561030 strong evidence that IL-18 and IL18Ralpha have important functions in the pathogenesis of allergic asthma
25729923 IL-37 requires the receptors IL-18Ralpha and IL-1R8 to carry out its multifaceted anti-inflammatory program upon innate signal transduction.
25500532 The architecture of the IL-18 receptor second domain (D2) is unique among the other IL-1R family members, which presumably distinguishes them from the IL-1 receptors that exhibit a more promiscuous ligand recognition mode.
25360588 polymorphisms in the interleukin 18 receptor 1 gene and tuberculosis susceptibility among Chinese
25327457 PDGFB and IL18R1 represent plausible candidates for studying the pathophysiology of these disorders in the context of TLR4 activation
25269704 Human memory IL-18Ralpha and DR3 CD4+ T cells may contribute to antigen-independent innate responses at barrier surfaces.
25261253 structural basis for the specific recognition of IL-18 by its alpha receptor
25170117 IL-18R downregulates IFN-alpha production by activation-induced splicing of IL-18Ralpha into 2 isoforms: the full-length receptor (IL-18Ralpha1) and a novel, truncated variant (IL-18Ralpha2), a competitive molecular decoy inhibiting canonical IL-18Ralpha1/IL-18Rbeta signaling.
24963217 IL-18, IL-18BP, and IL-18R may have roles in the pathogenesis of epithelial ovarian carcinoma
24909718 There was no association between the rs917997 in IL18R gene and rs187238 in IL18 gene polymorphisms and risk for non-Hodgkin's malignant lymphomas in Novosibirsk population.
24842757 results demonstrate clear functional consequences of the rs917997 risk polymorphism; this polymorphism leads to a loss-of-function through decreased IL-18RAP, IL-18R1, and IL-1R1 protein expression, which impairs autocrine IL-18 and IL-1 signaling
23963474 increased levels of soluble IL-18Ralpha complex in serum may also exert an antagonistic effect in vivo and play an important role in the inflammatory process in allergic asthma.
23901078 Association between single nucleotide polymorphisms in the IL18R1, IL18 and interferon-gamma genes and smallpox vaccine induced adaptive immunity.
23867815 HIV-1 gp120-treated vaginal epithelial cells show downregulation of interleukin 18 receptor 1 (IL18R1) expression as compared to untreated control
23103228 Our study reveals the important role of IL12/IL18-mediated transcriptional regulation of IFN-gamma production in leprosy.
22289858 Data suggest that IL-18RAP and IL-18R1 single-nucleotide polymorphisms identify African-American infants at risk for bronchopulmonary dysplasia.
22136483 Genetic variation in the promoter region of IL18, but not IL18R1, may be associated with knee osteoarthritis.
21965503 IL18 and its receptor may play an important role in the pathogenesis of allergic asthma.
21742843 IL18 and IL18R1 genes as plausible genes regulating the humoral immune response to smallpox vaccine in both Caucasians and African Americans.
21435242 The soluble IL-18Ralpha complex could be a potentially useful biomarker for the diagnosis of rheumatoid arthritis
20860503 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20833839 These data suggest a role for IL-1F family members in psoriasis.
20816195 Observational study of gene-disease association. (HuGE Navigator)
20627039 IL-18 and IL-18Ralpha might upregulate the expression of Th1-cytokines in immune thrombocytopenia patients.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20424473 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20354066 Report increased expression of IL18R1 in multiple sclerosis but did not find evidence of a genetic association with SNPs.
20354066 Observational study of gene-disease association. (HuGE Navigator)
20353565 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19954659 The levels of plasma IL-18 and IL-18R on CD3(+) lymphocytes were significantly increased in active phase immune thrombocytopenia than in remission phase and controls.
19910030 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19879772 These results demonstrate how IL-18 activity is regulated by TNFalpha and TGF-beta1, and how IFNgamma production through regulation of IL-18 receptor and T-bet expression.
19817957 Observational study of gene-disease association. (HuGE Navigator)
19592492 a role for SOCS1 and -3 in the seemingly paradoxical hyperresponsive state in cells deficient in IL-18Ralpha, supporting the concept that IL-18Ralpha participates in both pro- and anti-inflammatory responses
19473509 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19473509 Our analysis suggests that the variability of IL18R1 genes is unlikely to contribute to modulate the risk of cardiovascular disease
19394601 Interleukin-18 receptor expression may possibly be responsible for the pathologic process of adenomyosis.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19249008 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19180518 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of interleukin 18 receptor 1 (IL18R1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18774397 study provides suggestive evidence for associations of SNPs in the IL1RL1 gene and adjacently located family members IL18R1 and IL18RAP with asthma and atopy in 2 independent Dutch asthma populations
18774397 Observational study of gene-disease association. (HuGE Navigator)
18715339 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18382474 There is a significant association between polymorphisms of interleukin 18 receptor 1 and asthma.
18382474 Observational study of gene-disease association. (HuGE Navigator)
17703412 Observational study of gene-disease association. (HuGE Navigator)
17403771 A twofold increase in the percentage of CD4-resting T cells expressing IL-12Rbeta1 and IL-18Ralpha from HIV-1-infected patients; deregulation of the IL-12 and IL-18 pathways may play a role in the immunopathogenesis of HIV-1 infection.
16979683 our data show that variola virus IL-18BP prevents IL-18 from binding to IL-18R by interacting with three residues that are part of the binding site for hIL-18Ralpha.
16971411 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16467876 Two IFN-gammaR2 chains interact through species-specific determinants in their extracellular domains. Finally, these determinants also participate in the interaction of IFN-gammaR2 with IFN-gammaR1.
16236915 The overexpression of IL-18Ralpha predominantly by CD4+ T cells in sarcoidosis emphasizes crucial roles played by T-helper type 1 cells in the IL-18/IL-18Ralpha system in sarcoidosis
16043644 Observational study of gene-disease association. (HuGE Navigator)
15760905 IL-18, IL-18 receptor alpha, and CD48 complex formation via glycosylphosphatidylinositol anchor glycan triggers binding to IL-18 receptor beta, and thereby induces intracellular signal transduction and IFN-gamma production.
15323361 review of structure, function and tissue distribution of IL-18R [review]
15202785 Transfection of C33A cervical cancer cells with the IL-18 receptor induced IL-18 expression, and enhanced intracellular reactive oxygen species and Fas expression.
15063762 Observational study of gene-disease association. (HuGE Navigator)
15044087 Thus, our results identified a functional region in the IL-1R AcP required for the recruitment and activation of PI 3-kinase.
15009178 the promoter region of IL-18 receptor has two novel single nucleotide polymorphisms
14734551 IL-1F6, IL-1F8, and IL-1F9 signal through IL-1Rrp2 and IL-1RAcP in Jurkat cells.
14662859 The biologically active IL-8R complex requires the membrane-proximal third immunoglobulin-like domain in IL-18Ralpha for formation of IL-18R ternary complex as well as for signaling involved in IL-18-induced interferon-gamma in natural killer cells.
14662834 Expression of the IL-18 receptor is demonstrated on dendritic cells (DC) in peripheral blood and epidermis; on monocyte-derived DC its expression is up-regulated by interferon-gamma.

AA Sequence

MNCRELPLTLWVLISVSTAESCTSRPHITVVEGEPFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNP      1 - 70
RSSSRIALHDCVLEFWPVELNDTGSYFFQMKNYTQKWKLNVIRRNKHSCFTERQVTSKIVEVKKFFQITC     71 - 140
ENSYYQTLVNSTSLYKNCKKLLLENNKNPTIKKNAEFEDQGYYSCVHFLHHNGKLFNITKTFNITIVEDR    141 - 210
SNIVPVLLGPKLNHVAVELGKNVRLNCSALLNEEDVIYWMFGEENGSDPNIHEEKEMRIMTPEGKWHASK    211 - 280
VLRIENIGESNLNVLYNCTVASTGGTDTKSFILVRKADMADIPGHVFTRGMIIAVLILVAVVCLVTVCVI    281 - 350
YRVDLVLFYRHLTRRDETLTDGKTYDAFVSYLKECRPENGEEHTFAVEILPRVLEKHFGYKLCIFERDVV    351 - 420
PGGAVVDEIHSLIEKSRRLIIVLSKSYMSNEVRYELESGLHEALVERKIKIILIEFTPVTDFTFLPQSLK    421 - 490
LLKSHRVLKWKADKSLSYNSRFWKNLLYLMPAKTVKPGRDEPEVLPVLSES                       491 - 541
//

Text Mined References (81)

PMID Year Title
26600055 2015 Single Nucleotide Polymorphism of Interleukin-18 and Interleukin-18 Receptor and the Risk of Papillary Thyroid Cancer.
26561030 2015 Allergic airway inflammation: unravelling the relationship between IL-37, IL-18R? and Tir8/SIGIRR.
25729923 2015 IL-37 requires the receptors IL-18R? and IL-1R8 (SIGIRR) to carry out its multifaceted anti-inflammatory program upon innate signal transduction.
25642632 2015 Discovery of six new susceptibility loci and analysis of pleiotropic effects in leprosy.
25500532 2014 The structural basis for receptor recognition of human interleukin-18.
25360588 2014 Polymorphisms in the interleukin 18 receptor 1 gene and tuberculosis susceptibility among Chinese.
25327457 2014 Characterizing the genetic basis of innate immune response in TLR4-activated human monocytes.
25269704 2015 A major population of mucosal memory CD4+ T cells, coexpressing IL-18R? and DR3, display innate lymphocyte functionality.
25261253 2014 Structural basis for the specific recognition of IL-18 by its alpha receptor.
25250214 2014 Identification of a truncated splice variant of IL-18 receptor alpha in the human and rat, with evidence of wider evolutionary conservation.
25170117 2014 Human plasmacytoid dendritic cells regulate IFN-? production through activation-induced splicing of IL-18R?.
24963217 2014 Expression of IL-18, IL-18 binding protein, and IL-18 receptor by normal and cancerous human ovarian tissues: possible implication of IL-18 in the pathogenesis of ovarian carcinoma.
24909718 2014 Analysis of the association of polymorphic loci rs917997 in IL18RAP gene and rs187238 in IL18 gene with the risk for non-Hodgkin's malignant lymphomas in Novosibirsk population.
24842757 2014 The IL18RAP region disease polymorphism decreases IL-18RAP/IL-18R1/IL-1R1 expression and signaling through innate receptor-initiated pathways.
23963474 2013 Increased serum levels of soluble IL-18 receptor complex in patients with allergic asthma.
23901078 2013 Genetic variation in IL18R1 and IL18 genes and Inteferon ? ELISPOT response to smallpox vaccination: an unexpected relationship.
23817571 2013 Meta-analysis of genome-wide association studies identifies ten loci influencing allergic sensitization.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23103228 2012 Identification of IL18RAP/IL18R1 and IL12B as leprosy risk genes demonstrates shared pathogenesis between inflammation and infectious diseases.
23042114 2012 Genome-wide association study identifies eight new susceptibility loci for atopic dermatitis in the Japanese population.
23028483 2012 Genome-wide association studies of asthma in population-based cohorts confirm known and suggested loci and identify an additional association near HLA.
22561531 2012 Genome-wide association study to identify genetic determinants of severe asthma.
22289858 2012 IL-18R1 and IL-18RAP SNPs may be associated with bronchopulmonary dysplasia in African-American infants.
22136483 2012 Evaluation of IL18 and IL18R1 polymorphisms: genetic susceptibility to knee osteoarthritis.
21965503 2011 Interleukin-18 and interleukin-18 receptor-? expression in allergic asthma.
21742843 2011 Common SNPs/haplotypes in IL18R1 and IL18 genes are associated with variations in humoral immunity to smallpox vaccination in Caucasians and African Americans.
21435242 2011 Soluble interleukin-18 receptor complex is a novel biomarker in rheumatoid arthritis.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20860503 2010 A large-scale, consortium-based genomewide association study of asthma.
20833839 2010 IL-1RL2 and its ligands contribute to the cytokine network in psoriasis.
20816195 2010 Analyses of shared genetic factors between asthma and obesity in children.
20627039 2010 [Expression of interleukin-18 and interleukin-18 receptor alpha chain of the peripheral white blood cells in immune thrombocytopenia].
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20354066 2010 Interleukin 18 receptor 1 expression distinguishes patients with multiple sclerosis.
20353565 2010 Allelic variants of IL1R1 gene associate with severe hand osteoarthritis.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
19954659 2009 [The role of interleukin-18 and interleukin-18 receptor in predominant Th1 immune response of patients with immune thrombocytopenia].
19910030 2010 Evaluation of candidate genes in a genome-wide association study of childhood asthma in Mexicans.
19879772 2010 TNFalpha and TGF-beta1 influence IL-18-induced IFNgamma production through regulation of IL-18 receptor and T-bet expression.
19817957 2009 Secreted protein acidic and rich in cysteine (SPARC) gene polymorphism association with hepatocellular carcinoma in Italian patients.
19592492 2009 Increased cytokine production in interleukin-18 receptor alpha-deficient cells is associated with dysregulation of suppressors of cytokine signaling.
19473509 2009 Lack of association between polymorphisms of the IL18R1 and IL18RAP genes and cardiovascular risk: the MORGAM Project.
19394601 2010 Eutopic endometrial interleukin-18 system mRNA and protein expression at the level of endometrial-myometrial interface in adenomyosis patients.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19249008 2009 Diverse genome-wide association studies associate the IL12/IL23 pathway with Crohn Disease.
19180518 2009 Associations of 25 structural, degradative, and inflammatory candidate genes with lumbar disc desiccation, bulging, and height narrowing.
18774397 2008 Association of IL1RL1, IL18R1, and IL18RAP gene cluster polymorphisms with asthma and atopy.
18715339 2008 Associations between cytokine/cytokine receptor single nucleotide polymorphisms and humoral immunity to measles, mumps and rubella in a Somali population.
18382474 2008 Interleukin 18 receptor 1 gene polymorphisms are associated with asthma.
18311140 2008 Newly identified genetic risk variants for celiac disease related to the immune response.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17403771 2007 Skewed expression and up-regulation of the IL-12 and IL-18 receptors in resting and activated CD4 T cells from HIV-1-infected patients.
16979683 2007 Variola virus IL-18 binding protein interacts with three human IL-18 residues that are part of a binding site for human IL-18 receptor alpha subunit.
16971411 2006 IL18 and IL18R1 polymorphisms, lung CT and fibrosis: A longitudinal study in coal miners.
16467876 2006 Preassembly and ligand-induced restructuring of the chains of the IFN-gamma receptor complex: the roles of Jak kinases, Stat1 and the receptor chains.
16236915 2005 Enhanced expression of interleukin-18 receptor alpha chain by CD4+ T cells in sarcoidosis.
16043644 2005 Genetic analysis of the interleukin-18 system highlights the role of the interleukin-18 gene in cardiovascular disease.
15860756 2005 Angiotensin II enhances interleukin-18 mediated inflammatory gene expression in vascular smooth muscle cells: a novel cross-talk in the pathogenesis of atherosclerosis.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15760905 2005 Functional role played by the glycosylphosphatidylinositol anchor glycan of CD48 in interleukin-18-induced interferon-gamma production.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15323361 Interleukin 18 receptor.
15202785 2004 Up-regulation of reactive oxygen species (ROS) and resistance to Fas-mediated apoptosis in the C33A cervical cancer cell line transfected with IL-18 receptor.
15063762 2004 Genetic variations in humans associated with differences in the course of hepatitis C.
15044087 2004 The IL-1 receptor accessory protein is essential for PI 3-kinase recruitment and activation.
15009178 2004 Identification of two novel single nucleotide polymorphisms in the promoter of the human interleukin-18 receptor alpha.
14734551 2004 Interleukin (IL)-1F6, IL-1F8, and IL-1F9 signal through IL-1Rrp2 and IL-1RAcP to activate the pathway leading to NF-kappaB and MAPKs.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14662859 2003 Identification of a critical Ig-like domain in IL-18 receptor alpha and characterization of a functional IL-18 receptor complex.
14662834 2003 Human dendritic cells express the IL-18R and are chemoattracted to IL-18.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12096920 2002 Interleukin-1F7B (IL-1H4/IL-1F7) is processed by caspase-1 and mature IL-1F7B binds to the IL-18 receptor but does not induce IFN-gamma production.
10925275 2000 IFN-alpha and IL-12 induce IL-18 receptor gene expression in human NK and T cells.
10227969 1999 Cutting edge: generation of IL-18 receptor-deficient mice: evidence for IL-1 receptor-related protein as an essential IL-18 binding receptor.
10191101 1999 Interleukin-1 receptor cluster: gene organization of IL1R2, IL1R1, IL1RL2 (IL-1Rrp2), IL1RL1 (T1/ST2), and IL18R1 (IL-1Rrp) on human chromosome 2q.
9325300 1997 Purification and characterization of the human interleukin-18 receptor.
8898719 1996 Cloning of a cDNA encoding a novel interleukin-1 receptor related protein (IL 1R-rp2).
8626725 1996 IL-1Rrp is a novel receptor-like molecule similar to the type I interleukin-1 receptor and its homologues T1/ST2 and IL-1R AcP.