Property Summary

NCBI Gene PubMed Count 48
PubMed Score 97.43
PubTator Score 69.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis -2.000 1.3e-04
osteosarcoma -1.112 1.6e-06
glioblastoma 1.100 1.2e-05
interstitial cystitis 2.100 4.3e-04
adult high grade glioma 1.600 5.7e-04
pilocytic astrocytoma 2.100 5.0e-08
posterior fossa group A ependymoma 1.300 1.7e-04
ulcerative colitis 1.200 2.9e-04
chronic rhinosinusitis 1.004 3.8e-02
head and neck cancer and chronic obstruc... 1.300 5.2e-03

Gene RIF (35)

PMID Text
25807634 imbalance of IL-18/IL-18BP ratio in IgA nephropathy especially in patients with arteriolar lesions
25548255 The natural IL-18 inhibitor IL-18BP further regulates IL-18 activity in the extracellular environment. Review.
24963217 IL-18, IL-18BP, and IL-18R may have roles in the pathogenesis of epithelial ovarian carcinoma
24478434 HPV16 E7 oncoprotein increases production of the IL18BP in keratinocytes.
23873689 these data indicate that IL-18BP, which is produced in EOC in response to microenvironmental factors, may inhibit endogenous or exogenous IL-18 activity
23419721 Data suggest that the imbalance of IL-18/IL-18BP might play an important role in the pathogenesis of systemic juvenile idiopathic arthritis (SJIA) and it might go hand-in-hand with the severity of SJIA.
22913567 Due to highly significant increases in circulating IL-18BP in schizophrenia compared to controls, the levels of free IL-18 are not significantly different between schizophrenic groups.
22289535 The balance between interleukin-18 (IL-18) and its endogenous antagonist, IL-18 binding protein (IL-18BP), was evaluated in children with Henoch-Schonlein purpura.
21867627 Imbalance between IL-18 and IL-18BP may play an important role in pathogenesis of idiopathic thrombocytopenic purpura.
21656327 High IL-18 BP levels indicate the severity of existing glomerular injury in systemic lupus erythematosus.
21440322 In T2DM patients, 18 BP began to increase after IL-18 increased and reached a threshold, in which case kidney dysfunction would have developed.
21418867 IL-18/IL-18BP imbalance plays an important role in pathogenesis of primary immune thrombocytopenia.
21126942 increased levels of both IL-18 and its natural inhibitor IL-18BP, characterise SLE
21078084 In lines of intestinal epithelial cells from inflammatory bowel disease patients, interferon-gamma selectively up-regulated IL-18 binding protein.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
20140691 lupus nephritis patients present lower IL-18BP mRNA expression and higher serum levels of IL-18 than those in normal controls
20072626 Since IL-18 plays a major role in perpetuating hemophagocytosis, the failure of IFNgamma to induce IL-18BP may constitute a fundamental pathogenetic mechanism
19961286 Suggest that an early rise in IL-18 levels may play a role in reverse remodeling process following aortic valve replacement.
19699611 High circulating levels in patients with active Systemic Lupus Erythematosus
19394601 Endometrial interleukin-18 binding protein mRNA expression may possibly be responsible for the pathologic process of adenomyosis.
19046253 Altogether, data presented herein indicate that direct action of STAT1 on the IL-18BP promoter at the proximal GAS element is key to IL-18BP expression by IFN-gamma-stimulated DLD-1 colon carcinoma cells
18594952 Despite the elevated IL-18BP levels during active disease, free IL-18 remained higher than in the inactive disease stages, suggesting a potential benefit of administration of exogenous IL-18BP as a therapeutic approach for active Wegener's granulomatosis.
18092318 Observational study of gene-disease association. (HuGE Navigator)
17951325 Observational study of gene-disease association. (HuGE Navigator)
17951325 IL-18 levels, which are determined in part by variation in IL18/IL18BP, play a role in coronary heart disease development and postsurgery outcome.
16043644 Observational study of gene-disease association. (HuGE Navigator)
15188356 production of IL-18BP in response to IL-12 and IL-18 was regulated differently in blood and synovial cells.
12960225 High endogenous levels of IL-18BP in trangenic mice effectively neutralize IL-18 and are protective in response to different inflammatory stimuli.
12874202 Administration of recombinant human IL-18BP not only reduces symptoms of murine contact hypersensitivity (CHS) during the elicitation phase but also significantly decreases inflammation in mice that had previously undergone CHS without treatment.
12482935 IRF-1-CEBPbeta complex activate the promoter of IL-18 binding protein.
12381835 after binding to IL-18BP, IL-1F7b forms a complex with IL-18Rbeta, depriving the beta-chain of forming a functional receptor complex with IL-18Ralpha and thus inhibiting IL-18 activity
11907126 IL-18BP messenger transcript and protein are significantly increased in surgically resected specimens from active Crohn's disease compared with control patients, correlating with an up-regulation of IL-18.
11739524 trancriptional activation and release of IL-18 binding protein in response to IFN-gamma

AA Sequence

MTMRHNWTPDLSPLWVLLLCAHVVTLLVRATPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVT      1 - 70
WPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLT     71 - 140
PALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG                    141 - 194
//

Text Mined References (50)

PMID Year Title
25807634 2015 Imbalance of interleukin-18 and interleukin-18 binding protein in patients with IgA nephropathy implicating renal vasculopathy.
25548255 2015 Context-dependent role of IL-18 in cancer biology and counter-regulation by IL-18BP.
24963217 2014 Expression of IL-18, IL-18 binding protein, and IL-18 receptor by normal and cancerous human ovarian tissues: possible implication of IL-18 in the pathogenesis of ovarian carcinoma.
24478434 2014 Human papillomavirus E7 oncoprotein increases production of the anti-inflammatory interleukin-18 binding protein in keratinocytes.
23873689 2013 The IL-18 antagonist IL-18-binding protein is produced in the human ovarian cancer microenvironment.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23419721 2013 The imbalance of IL-18/IL-18BP in patients with systemic juvenile idiopathic arthritis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22913567 2012 Elevated levels of circulating IL-18BP and perturbed regulation of IL-18 in schizophrenia.
22289535 2011 Imbalance of interleukin-18 and interleukin-18 binding protein in children with Henoch-Schönlein purpura.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
21867627 2011 [Secretion of IL-18 and IL-18 binding protein from splenocytes of ITP patients in vitro].
21656327 2012 High circulating levels of interleukin-18 binding protein indicate the severity of glomerular involvement in systemic lupus erythematosus.
21440322 2011 Serum interleukin-18 binding protein increases with behavior different from IL-18 in patients with diabetic nephropathy.
21418867 2011 [Role of IL-18/IL-18BP balance in spleen of patients with primary immune thrombocytopenia].
21126942 2010 Serum and urinary levels of IL-18 and its inhibitor IL-18BP in systemic lupus erythematosus.
21078084 2011 Interfering with interferon-? signalling in intestinal epithelial cells: selective inhibition of apoptosis-maintained secretion of anti-inflammatory interleukin-18 binding protein.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20140691 2010 Expressions of IL-18 and its binding protein in peripheral blood leukocytes and kidney tissues of lupus nephritis patients.
20072626 2010 Failure of interferon gamma to induce the anti-inflammatory interleukin 18 binding protein in familial hemophagocytosis.
19961286 2010 Plasma IL-18 and IL-18BP are altered differently in reverse remodeling following aortic valve replacement.
19699611 2010 High circulating levels of free interleukin-18 in patients with active SLE in the presence of elevated levels of interleukin-18 binding protein.
19394601 2010 Eutopic endometrial interleukin-18 system mRNA and protein expression at the level of endometrial-myometrial interface in adenomyosis patients.
19046253 2009 Molecular mechanisms of IL-18BP regulation in DLD-1 cells: pivotal direct action of the STAT1/GAS axis on the promoter level.
18594952 2009 Interleukin-18 binding protein in the sera of patients with Wegener's granulomatosis.
18092318 2008 Comprehensive evaluation of positional candidates in the IL-18 pathway reveals suggestive associations with schizophrenia and herpes virus seropositivity.
17951325 2007 Free Interleukin (IL)-18 levels, and the impact of IL18 and IL18BP genetic variation, in CHD patients and healthy men.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16341674 2005 Transcriptome analysis of human gastric cancer.
16043644 2005 Genetic analysis of the interleukin-18 system highlights the role of the interleukin-18 gene in cardiovascular disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15188356 2004 Regulation of interleukin-18 binding protein production by blood and synovial cells from patients with rheumatoid arthritis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12960225 2003 Generation and characterization of mice transgenic for human IL-18-binding protein isoform a.
12874202 2003 IL-18 binding protein protects against contact hypersensitivity.
12482935 2002 The promoter of IL-18 binding protein: activation by an IFN-gamma -induced complex of IFN regulatory factor 1 and CCAAT/enhancer binding protein beta.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12381835 2002 A complex of the IL-1 homologue IL-1F7b and IL-18-binding protein reduces IL-18 activity.
11907126 2002 IL-18-binding protein expression by endothelial cells and macrophages is up-regulated during active Crohn's disease.
11890646 2001 Novel targets for interleukin 18 binding protein.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10655506 2000 Structural requirements of six naturally occurring isoforms of the IL-18 binding protein to inhibit IL-18.
10329540 1999 Identification of human and mouse homologs of the MC51L-53L-54L family of secreted glycoproteins encoded by the Molluscum contagiosum poxvirus.
10094485 1999 Cloning and expression of interleukin-18 binding protein.
10023777 1999 Interleukin-18 binding protein: a novel modulator of the Th1 cytokine response.