Property Summary

NCBI Gene PubMed Count 880
PubMed Score 2531.95
PubTator Score 2177.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (18)

Disease log2 FC p
psoriasis -1.200 4.3e-03
adult high grade glioma 1.300 3.9e-03
Astrocytoma, Pilocytic 1.500 7.4e-06
esophageal adenocarcinoma -2.100 4.4e-02
gastric carcinoma 1.800 1.9e-02
head and neck cancer -1.500 1.3e-02
interstitial cystitis -1.900 8.2e-04
invasive ductal carcinoma 1.100 6.1e-03
lung cancer -1.900 2.7e-03
lung carcinoma -3.400 1.0e-30
malignant mesothelioma -7.900 5.2e-10
medulloblastoma, large-cell -1.200 1.3e-05
osteosarcoma -2.489 1.7e-03
ovarian cancer -3.600 5.9e-11
pancreatic cancer 1.500 9.5e-05
primary Sjogren syndrome 1.300 5.0e-03
spina bifida -1.713 4.2e-02
subependymal giant cell astrocytoma 2.258 8.9e-03

 GO Function (1)

 GWAS Trait (1)

Protein-protein Interaction (2)

PDB (13)

Gene RIF (951)

AA Sequence

MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMT      1 - 70
DSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQR     71 - 140
SVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRSIMFTVQNED                     141 - 193
//

Text Mined References (883)

PMID Year Title