Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.73
PubTator Score 3.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
ulcerative colitis 2087 0.0 2.0
Disease Target Count Z-score Confidence
Inflammatory bowel disease 142 3.1 1.6

Expression

Gene RIF (3)

PMID Text
26480299 Rare Il17REL Variants are associated with Familial and Sporadic Inflammatory Bowel Disease.
20228798 We performed a genome-wide association analysis of ulcerative colitis and discovered new associations in il17rel
20228798 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MSRSVLEALTSSTAMQCVPSDGCAMLLRVRASITLHERLRGLEACAMSLDTQETQCQSVWVARASHRQQG      1 - 70
GQQLQVHFGCFAVSVAQHLYVTLRTIPHFCGVQLDQRHLVEAGKLSYWVDRRRKAILVQVPRASGSPDYY     71 - 140
LRLCLKRFTCEDAGAPVRVTANSVSQAVFLPYSQELPCLCLEGWSATPDAVRIQICPFENDTEALEVLWD    141 - 210
TVYYHPESQTLSWEPACPVSGHVSLCWRPGPGAGCRKLQQSSQLVHRRVQYPLVDTQPQLCLKFSTSWGS    211 - 280
WVRCPFEQRRFPTPPTSRCTCVTGGSHSSLPANAHSRPARSLQPQVTWQPPLLLPS                  281 - 336
//

Text Mined References (6)

PMID Year Title
26480299 2016 Whole-exome Sequence Analysis Implicates Rare Il17REL Variants in Familial and Sporadic Inflammatory Bowel Disease.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
20228798 2010 Genome-wide association study for ulcerative colitis identifies risk loci at 7q22 and 22q13 (IL17REL).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
10591208 1999 The DNA sequence of human chromosome 22.