Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.60
PubTator Score 6.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 8.2e-62
juvenile dermatomyositis 1189 1.3e-10

Expression

  Differential Expression (2)

Disease log2 FC p
juvenile dermatomyositis -1.067 1.3e-10
psoriasis -1.100 8.2e-62

Protein-protein Interaction (9)

Gene RIF (2)

PMID Text
21993849 IL-17RE as a receptor of IL-17C that regulates early innate immunity to intestinal pathogens.
20459687 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGSSRLAALLLPLLLIVIDLSDSAGIGFRHLPHWNTRCPLASHTDDSFTGSSAYIPCRTWWALFSTKPWC      1 - 70
VRVWHCSRCLCQHLLSGGSGLQRGLFHLLVQKSKKSSTFKFYRRHKMPAPAQRKLLPRRHLSEKSHHISI     71 - 140
PSPDISHKGLRSKRTQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPEVSVRLCHQWAL    141 - 210
ECEELSSPYDVQKIVSGGHTVELPYEFLLPCLCIEASYLQEDTVRRKKCPFQSWPEAYGSDFWKSVHFTD    211 - 280
YSQHTQMVMALTLRCPLKLEAALCQRHDWHTLCKDLPNATARESDGWYVLEKVDLHPQLCFKFSFGNSSH    281 - 350
VECPHQTGSLTSWNVSMDTQAQQLILHFSSRMHATFSAAWSLPGLGQDTLVPPVYTVSQARGSSPVSLDL    351 - 420
IIPFLRPGCCVLVWRSDVQFAWKHLLCPDVSYRHLGLLILALLALLTLLGVVLALTCRRPQSGPGPARPV    421 - 490
LLLHAADSEAQRRLVGALAELLRAALGGGRDVIVDLWEGRHVARVGPLPWLWAARTRVAREQGTVLLLWS    491 - 560
GADLRPVSGPDPRAAPLLALLHAAPRPLLLLAYFSRLCAKGDIPPPLRALPRYRLLRDLPRLLRALDARP    561 - 630
FAEATSWGRLGARQRRQSRLELCSRLEREAARLADLG                                     631 - 667
//

Text Mined References (12)

PMID Year Title
23054011 2013 Expression profiles of Th17 pathway related genes in human systemic lupus erythematosus.
21993849 2011 IL-17RE is the functional receptor for IL-17C and mediates mucosal immunity to infection with intestinal pathogens.
21993848 2011 IL-17C regulates the innate immune function of epithelial cells in an autocrine manner.
21982598 2011 Interleukin-17C promotes Th17 cell responses and autoimmune disease via interleukin-17 receptor E.
21732179 2011 Evolution of the IL17 receptor family in chordates: a new subfamily IL17REL.
20459687 2010 Candidate malaria susceptibility/protective SNPs in hospital and population-based studies: the effect of sub-structuring.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16310341 2006 Identification and functional characterization of a novel interleukin 17 receptor: a possible mitogenic activation through ras/mitogen-activated protein kinase signaling pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.