Property Summary

NCBI Gene PubMed Count 36
PubMed Score 36.59
PubTator Score 55.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

 CSPA Cell Line (2)

Gene RIF (27)

PMID Text
27000993 Therefore, IL-17E/IL-17RB signaling represents a potential therapeutic target for treatment of hepatocellular carcinoma
26990986 GS is acetylated at lysines 11 and 14, yielding a degron that is necessary and sufficient for binding and ubiquitylation by CRL4(CRBN) and degradation by the proteasome.
26728744 The Breast Cancer Index (BCI) is a continuous risk index model of two previously described biomarkers: molecular grade index (MGI) and HOXB13:IL17BR (H:I) ratio
26285835 Studies indicate that interleukin 17 (IL-17B)/interleukin 17 receptor B (IL-17RB) signaling is essential for pancreatic cancer malignancy.
25732306 IL-17RB has an essential role in pancreatic cancer growth, invasion, and metastasis.
24247484 The increased IL-25 levels in plasma and the expression of IL-17RA and IL-17RB on eosinophils in allergic asthma patients suggests that IL-25 may activate eosinophils during allergic inflammation.
23851503 Results show that amplified signaling of interleukin-17 receptor B (IL-17RB) and its ligand IL-17B promot tumorigenicity in breast cancer cells and impeded acinus formation in immortalized normal mammary epithelial cells.
23497539 High IL17RB expression is associated with breast cancer.
22070932 In summary we established a new mechanism of IL17RB regulation-Smurf2 dependent degradation of its adaptor protein DAZAP2.
21570719 Allergen provocation induces functionally relevant, increased expression of IL-25 and its receptor in the asthmatic bronchial mucosa and dermis of sensitized atopic subjects.
21473777 Results indicate that IL17RB may be the only gene expressed in CD4+ T cells whose transcript measurement is correlated with the variation in IgE level in asthmatics, but correlation between IL17RB and IgE was restricted to males only.
21252617 The present study identified upregulation of IL17RB during natural allergen exposure in patients with seasonal allergic rhinitis (SAR).
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20545698 Increased expression of IL-17RB on allergen-challenged basophil is regulated by IL-3, inhibits apoptosis and promotes IgE-mediated degranulation of basophils
20453000 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19118269 Our results revealed that the IL-17RB +5661 G>A locus has a dominant and protective genetic effect on the development of asthma.
19118269 Observational study of gene-disease association. (HuGE Navigator)
18794098 An index composed of inherited (CYP2D6) and tumor (HOXB13/IL17BR) gene variation identifies patients with varying degrees of resistance to tamoxifen.
18794098 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17975144 HOXB13, IL17BR, and CHDH are regulated by estrogen in breast cancer
17453342 HOXB13 and IL17BR have roles in breast cancer
17008703 HOXB13 and IL17BR has a role in progression of early-stage breast cancer
16609019 The IL17RB protein expression increases during disease progression of breast cancer to hormonal therapy.
16609001 The IL17RB protein expression increases during disease progression of breast cancer to hormonal therapy.

AA Sequence

MSLVLLSLAALCRSAVPREPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSW      1 - 70
VLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHN     71 - 140
IPNANMNEDGPSMSVNFTSPGCLDHIMKYKKKCVKAGSLWDPNITACKKNEETVEVNFTTTPLGNRYMAL    141 - 210
IQHSTIIGFSQVFEPHQKKQTRASVVIPVTGDSEGATVQLTPYFPTCGSDCIRHKGTVVLCPQTGVPFPL    211 - 280
DNNKSKPGGWLPLLLLSLLVATWVLVAGIYLMWRHERIKKTSFSTTTLLPPIKVLVVYPSEICFHHTICY    281 - 350
FTEFLQNHCRSEVILEKWQKKKIAEMGPVQWLATQKKAADKVVFLLSNDVNSVCDGTCGKSEGSPSENSQ    351 - 420
DLFPLAFNLFCSDLRSQIHLHKYVVVYFREIDTKDDYNALSVCPKYHLMKDATAFCAELLHVKQQVSAGK    421 - 490
RSQACHDGCCSL                                                              491 - 502
//

Text Mined References (36)

PMID Year Title
27000993 2016 Non-CSCs nourish CSCs through interleukin-17E-mediated activation of NF-?B and JAK/STAT3 signaling in human hepatocellular carcinoma.
26990986 2016 Glutamine Triggers Acetylation-Dependent Degradation of Glutamine Synthetase via the Thalidomide Receptor Cereblon.
26728744 2016 Assessment of the prognostic and predictive utility of the Breast Cancer Index (BCI): an NCIC CTG MA.14 study.
26285835 2015 Targeting interleukin-17 receptors.
25732306 2015 Targeting IL-17B-IL-17RB signaling with an anti-IL-17RB antibody blocks pancreatic cancer metastasis by silencing multiple chemokines.
24247484 2014 IL-25 and IL-25 receptor expression on eosinophils from subjects with allergic asthma.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23851503 2014 Autocrine/paracrine mechanism of interleukin-17B receptor promotes breast tumorigenesis through NF-?B-mediated antiapoptotic pathway.
23497539 2013 HOXB13:IL17BR and molecular grade index and risk of breast cancer death among patients with lymph node-negative invasive disease.
22070932 2012 Smurf2 regulates IL17RB by proteasomal degradation of its novel binding partner DAZAP2.
21570719 2011 Allergen-induced expression of IL-25 and IL-25 receptor in atopic asthmatic airways and late-phase cutaneous responses.
21473777 2011 The CD4+ T-cell transcriptome and serum IgE in asthma: IL17RB and the role of sex.
21252617 2011 Upregulation of IL17RB during natural allergen exposure in patients with seasonal allergic rhinitis.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20545698 2010 Allergen challenge of peripheral blood mononuclear cells from patients with seasonal allergic rhinitis increases IL-17RB, which regulates basophil apoptosis and degranulation.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19118269 2009 Association of IL-17RB gene polymorphism with asthma.
18794098 2008 Cytochrome P450 2D6 and homeobox 13/interleukin-17B receptor: combining inherited and tumor gene markers for prediction of tamoxifen resistance.
17975144 2007 The prognostic biomarkers HOXB13, IL17BR, and CHDH are regulated by estrogen in breast cancer.
17453342 2008 Exploring the two-gene ratio in breast cancer--independent roles for HOXB13 and IL17BR in prediction of clinical outcome.
17008703 2006 The HOXB13:IL17BR expression index is a prognostic factor in early-stage breast cancer.
16609019 2006 A two-gene expression ratio of homeobox 13 and interleukin-17B receptor for prediction of recurrence and survival in women receiving adjuvant tamoxifen.
16609001 2006 Genomic testing for sensitivity of breast cancer to hormonal therapy.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14759258 2004 An unappreciated role for RNA surveillance.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11058597 2001 IL-17E, a novel proinflammatory ligand for the IL-17 receptor homolog IL-17Rh1.
10815801 2000 Evi27 encodes a novel membrane protein with homology to the IL17 receptor.
10749887 2000 A novel cytokine receptor-ligand pair. Identification, molecular characterization, and in vivo immunomodulatory activity.
10748240 2000 Requirement of tumor necrosis factor receptor-associated factor (TRAF)6 in interleukin 17 signal transduction.